Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag)

Beta LifeScience SKU/CAT #: BLA-10249P

Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag)

Beta LifeScience SKU/CAT #: BLA-10249P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Pseudomonas aeruginosa
Accession P54292
Synonym Elastase modulator lasM rhlR vsmR
Description Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag) was expressed in E.coli. It is a Full length protein
Source E.coli
AA Sequence MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHT IPFTRPKTEVHGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSL FDQSRMLWNEARDWGLCVGATLPIRAPNNLLSVLSVARDQQNISSFEREE IRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADGKSSGE IAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGLI
Molecular Weight 48 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Necessary for transcriptional activation of the rhlAB genes encoding the rhamnosyltransferase. It also functions as a transcriptional activator of elastase structural gene (lasB). Binds to autoinducer molecules BHL (N-butanoyl-L-homoserine lactone), and HHL (N-hexanoyl-L-homoserine lactone).
Protein Families Autoinducer-regulated transcriptional regulatory protein family
Database References

Gene Functions References

  1. this work shows that PqsE and RhlR function as a QS-autoinducer synthase-receptor pair that drives group behaviors in P. aeruginosa. PMID: 30224496
  2. rhlR/lasR knockout increased the susceptibility of Pseudomonas aeruginosa towards polymyxin B-azithromycin combination via influencing quorum sensing. PMID: 28096154
  3. This is the first time that a domain of the quorum sensing regulator RhlR was produced in sufficient amounts for structural studies, enabling the investigation of the molecular basis for RhlR specific interaction with DNA promoters. PMID: 26792557
  4. Quorum sensing genes lasR and rhlR and activity of electric field sensitive enzyme, glycerol-3-phosphate dehydrogenase was also repressed by WED. PMID: 25803639
  5. Subinhibitory concentrations of macrolides specifically upregulated expression of quorum sensing genes (rhlR, lasI), whereas sulfonamides and municipal wastewater, instead upregulated expression of specific resistant genes (sul1) and efflux pumps (mexD). PMID: 23392972
  6. The rmlBDAC operon has three promoters, and that the expression of the P2 promoter is dependent on the stationary phase sigma factor sigmaS and on the quorum sensing regulator RhlR. PMID: 22262098
  7. rhlR transcription is subject to positive-feedback autoregulation through RhlR/C4-HSL activation of the rhlA promoter. PMID: 21719541
  8. RhlR and LasR regulate the anthranilate metabolism in a mutually antagonistic and growth phase-differential manner. PMID: 21614486
  9. Analysis of rpoS gene and the rhlR gene per cell showed that P. aeruginosa cells express different proteins according to their location in the biofilm. PMID: 20348255
  10. MvfR contributes to P. aeruginosa virulence by controlling the transcription of genes not under RhlR regulation. PMID: 15686549
  11. down-regulation of the T3S regulon in the presence of RhlR-C4HSL and the corresponding advanced secretion of ExoS in a rhlI mutant. PMID: 15901720
  12. Data found that lon-disrupted cells show increased levels of a transcriptional regulator, RhlR. PMID: 18408026
  13. RhlR is able to induce LasR-regulated genes in the absence of lasR. PMID: 19246742

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed