Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag)
Beta LifeScience
SKU/CAT #: BLA-10249P
Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag)
Beta LifeScience
SKU/CAT #: BLA-10249P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pseudomonas aeruginosa |
Accession | P54292 |
Synonym | Elastase modulator lasM rhlR vsmR |
Description | Recombinant Pseudomonas aeruginosa Regulatory Protein RhlR (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHT IPFTRPKTEVHGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSL FDQSRMLWNEARDWGLCVGATLPIRAPNNLLSVLSVARDQQNISSFEREE IRLRLRCMIELLTQKLTDLEHPMLMSNPVCLSHREREILQWTADGKSSGE IAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGLI |
Molecular Weight | 48 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Necessary for transcriptional activation of the rhlAB genes encoding the rhamnosyltransferase. It also functions as a transcriptional activator of elastase structural gene (lasB). Binds to autoinducer molecules BHL (N-butanoyl-L-homoserine lactone), and HHL (N-hexanoyl-L-homoserine lactone). |
Protein Families | Autoinducer-regulated transcriptional regulatory protein family |
Database References | KEGG: pae:PA3477 STRING: 208964.PA3477 |
Gene Functions References
- this work shows that PqsE and RhlR function as a QS-autoinducer synthase-receptor pair that drives group behaviors in P. aeruginosa. PMID: 30224496
- rhlR/lasR knockout increased the susceptibility of Pseudomonas aeruginosa towards polymyxin B-azithromycin combination via influencing quorum sensing. PMID: 28096154
- This is the first time that a domain of the quorum sensing regulator RhlR was produced in sufficient amounts for structural studies, enabling the investigation of the molecular basis for RhlR specific interaction with DNA promoters. PMID: 26792557
- Quorum sensing genes lasR and rhlR and activity of electric field sensitive enzyme, glycerol-3-phosphate dehydrogenase was also repressed by WED. PMID: 25803639
- Subinhibitory concentrations of macrolides specifically upregulated expression of quorum sensing genes (rhlR, lasI), whereas sulfonamides and municipal wastewater, instead upregulated expression of specific resistant genes (sul1) and efflux pumps (mexD). PMID: 23392972
- The rmlBDAC operon has three promoters, and that the expression of the P2 promoter is dependent on the stationary phase sigma factor sigmaS and on the quorum sensing regulator RhlR. PMID: 22262098
- rhlR transcription is subject to positive-feedback autoregulation through RhlR/C4-HSL activation of the rhlA promoter. PMID: 21719541
- RhlR and LasR regulate the anthranilate metabolism in a mutually antagonistic and growth phase-differential manner. PMID: 21614486
- Analysis of rpoS gene and the rhlR gene per cell showed that P. aeruginosa cells express different proteins according to their location in the biofilm. PMID: 20348255
- MvfR contributes to P. aeruginosa virulence by controlling the transcription of genes not under RhlR regulation. PMID: 15686549
- down-regulation of the T3S regulon in the presence of RhlR-C4HSL and the corresponding advanced secretion of ExoS in a rhlI mutant. PMID: 15901720
- Data found that lon-disrupted cells show increased levels of a transcriptional regulator, RhlR. PMID: 18408026
- RhlR is able to induce LasR-regulated genes in the absence of lasR. PMID: 19246742