Recombinant Pseudomonas aeruginosa plcH Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10247P
Recombinant Pseudomonas aeruginosa plcH Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10247P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pseudomonas aeruginosa |
Accession | P06200 |
Description | Recombinant Pseudomonas aeruginosa plcH Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | VQHVVILMQENRSFDHYFGHLNGVRGFNDPRALKRQDGKPVWYQNYKYEF SPYHWDTKVTSAQWVSSQNHEWSAFHAIWNQGRNDKWMAVQYPEAMGYFK RGDIPYYYALADAFTLCEAYHQSMMGPTNPNRLYHMSGRAAPSGDGKDVH IGNDMGDGTIGASGTVDWTTYPERLSAAGVDWRVYQEGGYRSSSLWYLYV DAYWKYRLQEQNNYDCNALAWFRNFKNAPRDSDLWQRAMLARGVDQLRKD VQENTLPQVSWIVAPYCYCEHPWWGPSFGEYYVTRVLEALTSNPEVWART VFILNYDEGDGFYDHASAPVPPWKDGVGLSTVSTAGEIEVSSGLPIGLGH RVPLIAISPWSKGGKVSAEVFDHTSVLRFLERRFGV |
Molecular Weight | 64 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Hydrolyzes sphingomyelin in addition to phosphatidylcholine. |
Protein Families | Bacterial phospholipase C family |
Database References | KEGG: pae:PA0844 STRING: 208964.PA0844 |
Gene Functions References
- Authors demonstrated the presence of a negative feedback loop in which Anr repressed plcH transcription in cells grown at low oxygen. PMID: 25073853
- The data suggest that PlcH activity promotes Anr activity in oxic environments and that Anr activity contributes to virulence. PMID: 23667230