Recombinant Pseudomonas aeruginosa ompF Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10246P
Recombinant Pseudomonas aeruginosa ompF Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10246P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pseudomonas aeruginosa |
Accession | P13794 |
Synonym | orpF Putative outer membrane porin F protein YE1563 |
Description | Recombinant Pseudomonas aeruginosa ompF Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | QGQNSVEIEAFGKRYFTDSVRNMKNADLYGGSIGYFLTDDVELALSYGEY HDVRGTYETGNKKVHGNLTSLDAIYHFGTPGVGLRPYVSAGLAHQNITNI NSDSQGRQQMTMANIGAGLKYYFTENFFAKASLDGQYGLEKRDNGHQGEW MAGLGVGFNFGGSKAAPAPEPVADVCSDSDNDGVCDNVDKCPDTPANVTV DANGCPAVAEVVRVQLDVKFDFDKSKVKENSYADIKNLADFMKQYPSTST TVEGHTDSVGTDAYNQKLSERRANAVRDVLVNEYGVEGGRVNAVGYGESR PVADNATAEGRAINRRVEAEVEAEAK |
Molecular Weight | 39 kDa including tags |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Has porin activity, forming small water-filled channels. Also has a structural role in determining cell shape and ability to grow in low-osmolarity medium. |
Subcellular Location | Cell outer membrane; Multi-pass membrane protein. |
Protein Families | OmpA family |
Database References | KEGG: pae:PA1777 STRING: 208964.PA1777 |
Gene Functions References
- OprF (an outer membrane porin, highly conserved in the Pseudomonas) binds human C3b. PMID: 25964476
- LecB binds to the outer membrane protein OprF PMID: 23056489
- oprF transcription was increased in response to low NaCl or high sucrose concentrations, and this induced transcription was strongly impaired in the absence of SigX. PMID: 22685281
- Prevention of disulfide bond formation in OprF increases its pore-forming activity. PMID: 20978537
- This is the first study showing a link between OprF, PQS synthesis, T3SS, and virulence factor production PMID: 21189321
- Data show that the recombinant plasmid pIRES-tPA-OprF-MyD88 has been successfully constructed and tPA-OprF and MyD88 protein can be highly expressed in transfected cells. PMID: 19257978
- findings suggest that OprF could adopt two alternative conformations in the outer membrane and that folding is thermoregulated PMID: 15528532
- findings demonstrate that interferon-gamma binds to an outer membrane protein in Pseudomonas aeruginosa, OprF, resulting in the expression of a quorum-sensing dependent virulence determinant, the PA-I lectin PMID: 16051797
- analysis of OprF from Pseudomonas aeruginosa PMID: 16397890
- OprF exists in two different conformations PMID: 16595653
- analysis of Pseudomonas aeruginosa porin OprF PMID: 16617058
- Major outer membrane protein F (OprF) is identified as a protein with important functions; mutant Pseudomonas aeruginosa deficient in OprF negates the antibacterial role of host neutrophil elastase both in vitro and in a pneumonia model. PMID: 18802098