Recombinant Polymerase cofactor VP35 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10240P

Recombinant Polymerase cofactor VP35 Protein (Tagged)

Beta LifeScience SKU/CAT #: BLA-10240P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Zaire ebolavirus
Accession Q6V1Q9
Description Recombinant Polymerase cofactor VP35 Protein (Tagged) was expressed in Mammalian. It is a Full length protein
Source Mammalian
AA Sequence MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENN PGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQ TIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTG RATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAF NNLDSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLG KDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSR GDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Molecular Weight 41 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling. Acts as a polymerase cofactor in the RNA polymerase transcription and replication complexes. Serves as nucleoprotein/NP monomer chaperone prior to the formation of the large oligomeric RNA-bound complexes. Regulates RNA synthesis by modulating NP-RNA interactions and interacting with DYNLL1. VP35-NP interaction controls the switch between RNA-bound NP and free NP and thus the switch between genome replication and genome packaging into the nucleocapsid. Prevents establishment of cellular antiviral state, thereby suppressing host DC maturation. Acts by inhibiting host DDX58/RIG-I activation both by shielding dsRNA from detection and by preventing PRKRA binding to DDX58. Blocks virus-induced phosphorylation and activation of interferon regulatory factor 3/IRF3, a transcription factor critical for the induction of interferons alpha and beta. This blockage is produced through the interaction with and inhibition of host IKBKE and TBK1, producing a strong inhibition of the phosphorylation and activation of IRF3. Also inhibits the antiviral effect mediated by the host interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR. Increases PIAS1-mediated SUMOylation of IRF7, thereby repressing interferon transcription. Also acts as a suppressor of RNA silencing by interacting with host DICER1, TARBP2/TRBP and PRKRA/PACT. As a dimer, binds and sequesters dsRNA contributing to the inhibition of interferon production.
Subcellular Location Virion. Host cytoplasm.
Protein Families Filoviridae polymerase cofactor VP35 family

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed