Recombinant Pig Rhodopsin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10229P
Recombinant Pig Rhodopsin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10229P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | O18766 |
Synonym | CSNBAD1 MGC138309 MGC138311 OPN 2 OPN2 opsd OPSD_HUMAN opsin 2 Opsin 2 rod pigment Opsin-2 Opsin2 Retinitis Pigmentosa 4 Retinitis pigmentosa 4 autosomal dominant RHO Rhodopsin RP 4 RP4 |
Description | Recombinant Pig Rhodopsin Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ |
Molecular Weight | 38 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling. |
Subcellular Location | Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. |
Protein Families | G-protein coupled receptor 1 family, Opsin subfamily |
Database References |
Gene Functions References
- the rhodopsin is densely packed in the retina and the rhodopsin molecules are not aligned well. PMID: 22842041
- Phototransduction, even when initiated by wild type rhodopsin, is altered in a way progressive with level of retinal degeneration. A model introduces idea of binding site for carboxy terminus of rhodopsin on rhodopsin kinase. PMID: 16402026