Recombinant Pig P cadherin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10226P
Recombinant Pig P cadherin Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10226P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | O18926 |
Synonym | CADH3_HUMAN Cadherin 3 Cadherin 3 precursor Cadherin 3 type 1 Cadherin-3 Cadp Calcium dependent adhesion protein placental CDH 3 CDH3 CDH3 protein CDHP HJMD P cadherin (placental) P-cadherin PCAD Placental cadherin |
Description | Recombinant Pig P cadherin Protein (Tagged) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | KIAKYELFGHAVSENGASVEEPMNISIIVTDQNDHKPKFTQDVFRGSVLE GVLPGTSVMQVTATDEDDAINTYNGVVAYSILSQEPKDPHDLMFTVHRST GAISVISSGLDRERVPEYTLTIQATDMDGDGSSTTATAIVEILDA |
Molecular Weight | 32 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database References | STRING: 9823.ENSSSCP00000021843 UniGene: Ssc.42148 |