Recombinant Pig Oxyntomodulin Protein
Beta LifeScience
SKU/CAT #: BLA-10224P
Recombinant Pig Oxyntomodulin Protein
Beta LifeScience
SKU/CAT #: BLA-10224P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Synonym | GCG GLP-1 GLP-1(7-36) GLP-1(7-37) GLP-2 GLP1 GLP2 GLUC_HUMAN Glucagon-like peptide 2 GRPP OXM OXY TKS1225 |
Description | Recombinant Pig Oxyntomodulin Protein was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycle. |