Recombinant Pig IL5 Protein
Beta LifeScience
SKU/CAT #: BLA-0955P
Recombinant Pig IL5 Protein
Beta LifeScience
SKU/CAT #: BLA-0955P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | Q9MYM5 |
Synonym | B-cell differentiation factor I Colony stimulating factor EDF Eosinophil differentiation factor IL-5 IL5 IL5_HUMAN Interleukin 5 Interleukin 5 (colony stimulating factor, eosinophil) Interleukin-5 T Cell Replacing Factor T-cell replacing factor TRF |
Description | Recombinant Pig IL5 Protein was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | VENTMNRLVAETLTLLSIHRTLLIGDGNLMISTPVHTNHQLCIEEVFQGI DTLKNQTARGDAVEKLFQNLSLIKEYIDRQKKNCGGERWRVTQFLDYLQV FLGVINTEWTMES |
Molecular Weight | 17 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
Subcellular Location | Secreted. |
Protein Families | IL-5 family |
Database References |