Recombinant Pig IL33 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0950P
Recombinant Pig IL33 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-0950P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | M5B263 |
Synonym | C9orf26 CHROMOSOME 9 OPEN READING FRAME 26 DKFZp586H0523 DVS27 DVS27 related protein IL 1F11 IL 33 IL-1F11 IL-33 IL1F11 IL33 IL33_HUMAN Interleukin 1 family member 11 Interleukin 33 INTERLEUKIN 33 NFHEV Interleukin 33 precursor Interleukin-1 family member 11 Interleukin-33 (109-270) Interleukin33 NF HEV NF-HEV NFEHEV NFHEV Nuclear factor for high endothelial venules Nuclear factor from high endothelial venules OTTHUMP00000021041 RP11 575C20.2 |
Description | Recombinant Pig IL33 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPS SETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFF VLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKL SNLM |
Molecular Weight | 45 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |