Recombinant Pig IL12 p40 Protein
Beta LifeScience
SKU/CAT #: BLA-0938P
Recombinant Pig IL12 p40 Protein
Beta LifeScience
SKU/CAT #: BLA-0938P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | Q28938 |
Synonym | CLMF CLMF p40 CLMF2 Cytotoxic lymphocyte maturation factor 40 kDa subunit IL 12 subunit p40 IL 12B IL-12 subunit p40 IL-12B IL12 p40 IL12 subunit p40 IL12B IL12B_HUMAN interleukin 12 beta chain Interleukin 12 p40 Interleukin 12 subunit beta Interleukin 12B Interleukin-12 subunit beta natural killer cell stimulatory factor 40 kD subunit NK cell stimulatory factor chain 2 NKSF NKSF2 p40 |
Description | Recombinant Pig IL12 p40 Protein was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | IWELEKNVYVVELDWYPNAPGEMVVLTCNTPEEDGITWTSDQSSEVLGTG KTLTIHVKEFGDAGQYTCRKGGAVLSQSLLLLHKKEDGIWSTDILKDQKE PKNKSFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGSTDPRGVTCGT ATLSEDLGEYKKYRVECQEGSACPAAEESLPIEVVLEAVHKLKYENYTSS FFIRDIIKPDPPKNLQLNPLKNSRHVEISWEYPDTWSTPHSYFSLMFGVQ VQGKNKREKKDKLFTDQISAKVTCHKDANIRVQARDRYYSSSWSEWASVS CN |
Molecular Weight | 34 kDa |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |