Recombinant Pig GPX5 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10222P
Recombinant Pig GPX5 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10222P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Pig |
Accession | O18994 |
Synonym | Arep arMEP24 EGLP Epididymal androgen related protein Epididymal secretory glutathione peroxidase epididymis secretory sperm binding protein Li 75p Epididymis specific glutathione peroxidase like protein Epididymis-specific glutathione peroxidase-like protein Glutathione peroxidase 5 Glutathione peroxidase 5 (epididymal androgen related protein) Glutathione peroxidase, epididymal GPx-5 GPX5 GPX5_HUMAN GSHPx-5 HEL-S-75p Major androgen regulated protein OTTHUMP00000017919 OTTHUMP00000214636 |
Description | Recombinant Pig GPX5 Protein (Tagged) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYC GLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVR PGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEP IRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE |
Molecular Weight | 26 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. |
Subcellular Location | Secreted. |
Protein Families | Glutathione peroxidase family |
Database References | |
Tissue Specificity | Proximal caput epididymis. |
Gene Functions References
- Sperm TPI content and amounts of GPX5 in seminal plasma may be used as quality markers of boar sperm. PMID: 26711247