Recombinant OmpA Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10203P
Recombinant OmpA Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10203P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Salmonella enterica |
Accession | S4JJH7 |
Synonym | Outer membrane protein P5 |
Description | Recombinant OmpA Protein (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTL TGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGV DASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ |
Molecular Weight | 19 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |