Recombinant Non-capsid Protein NS-1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10193P
Recombinant Non-capsid Protein NS-1 (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10193P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human parvovirus B19 |
Accession | P07298 |
Description | Recombinant Non-capsid Protein NS-1 (Tagged) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | MELFRGVLQVSSNVLDCANDNWWCSLLDLDTSDWEPLTHTNRLMAIYLSS VASKLDFTGGPLAGCLYFFQVECNKFEEGYHIHVVTGGPGLNPRNLTVCV EGLFNNVLYHLVTENVKLKFLPGMTTKGKYFRDGEQFIENYLMKKIPLNV VWCVTNIDGYIDTCISATFRRGACHAKKPRITTAINDTSSDAGESSGTGA EVVPFNGKGTKASIKFQTMVNWLCENRVFTEDKWKLVDFNQYTLLSSSHS GSFQI |
Molecular Weight | 45 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Multifunctional protein essential for viral DNA replication, which cooperatively interacts with the viral DNA origin of replication and transactivates several promoters including the viral p6 promoter. Binds the origin of replication and performs an endonucleolytic nick within a conserved sequence in the viral genome, thereby initiating the rolling circle replication (RCR). Participates in the transcriptional regulation the viral p6 promoter that regulates all viral transcripts and the cellular CDN1A or IL6 promoters. Transactivates several host promoters some of which induce the S cell cycle phase for the production of host replicative proteins. Upregulates the expression of host E2F4 and E2F5 and interacts with both these factors thereby inhibiting the host cell cycle G2/M transition. This arrest promotes apoptosis for viral release. |
Subcellular Location | Host nucleus. |
Protein Families | Parvoviruses non-capsid protein family |