Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10187P
Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10187P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mycobacterium tuberculosis |
Accession | P9WQP2 |
Synonym | 85 A 85A Ag85A Antigen 85 A Antigen 85 complex A Antigen 85A Fbp A FbpA Fibronectin binding protein A Mpt 44 Mpt44 Mycobacterium tuberculosis antigen 85A Mycolyl transferase 85 A Mycolyl transferase 85A Rv3804c Secreted antigen Ag85A |
Description | Recombinant Mycobacterium tuberculosis TB Ag85A Protein (His tag) was expressed in E.coli. It is a Protein fragment |
Source | E.coli |
AA Sequence | YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT |
Molecular Weight | 34 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM. FbpA mediates triacylglycerol (TAG) formation with long-chain acyl-CoA as the acyl donor and 1,2-dipalmitoyl-sn-glycerol (1,2-dipalmitin) as the acyl acceptor. |
Subcellular Location | Secreted, cell wall. Cytoplasm. |
Protein Families | Mycobacterial A85 antigen family |
Database References | KEGG: mtc:MT3911 |