Recombinant Mouse TLR7 Protein (Tagged)

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P58681
Synonym	PRO285 TLR 7 Tlr7 TLR7_HUMAN Toll like receptor 7 Toll-like receptor 7 UNQ248
Description	Recombinant Mouse TLR7 Protein (Tagged) was expressed in Mammalian. It is a Protein fragment
Source	Mammalian
AA Sequence	FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINH IPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGL SDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIET LYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPN LLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENN SPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYL AREIEEAKFLHFLPNLVELDFS
Molecular Weight	121 kDa
Purity	>85% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce proinflammatory cytokines and interferons, respectively.
Subcellular Location	Endosome membrane. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome. Cytoplasmic vesicle, phagosome. Note=Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
Protein Families	Toll-like receptor family
Database References	KEGG: mmu:170743 STRING: 10090.ENSMUSP00000061853 UniGene: Mm.23979

Gene Functions References

Results suggest that toll-like receptor 7 (TLR7) needs to move to the cell periphery to induce robust type I interferon responses in plasmacytoid dendritic cells (pDC). PMID: 29150602
The results demonstrate that TLR7 activation may trigger innate immunity pathways and induce apoptosis and hypoplasia of neonatal biliary trees in Balb/c mice. The novel findings give an implication of pathogenesis of infantile cholestasis, such as biliary atresia. PMID: 27590984
TLR7 deletion reduces atherosclerosis in apolipoprotein E-deficient mice. PMID: 28405010
SZU-101 enhances tumor clearance in vivo, without affecting the TLR7-NF-kappaB pathway activated by the TLR7 agonist in mouse spleen lymphocytes and bone marrow dendritic cells PMID: 28000738
Up-regulation of TLR7 could eliminate intracellular Mtb through autophagy PMID: 28419514
conclude that VDD promotes tumor growth in the context of Smad3 disruption, potentially through regulation of TLR7 expression and beta-catenin activation PMID: 27456065
activation of TLR7 in the mouse bladder induced cystitis with sensory hyperactivity of the bladder PMID: 28595240
Here, we show that under these circumstances, the Toll-like receptor (TLR)-7/8 ligand imiquimod, but not the TLR3 ligand poly I:C or TLR9 ligand CpG, mediated an effective antitumor response. The rejection of these immune-escaped cancers was mediated by NK cells and CD4(+) T cells, whereas activated CD8(+) T cells were dispensable PMID: 28637878
TLR7 prevents progression of non-alcoholic fatty liver disease via induced autophagy and released IGF-1 from liver. These findings suggest a new therapeutic strategy for the treatment of NAFLD. PMID: 27279075
Toll-like receptor 2 (TLR2) controls random motility, while Toll-like receptor 7 (TLR7) regulates chemotaxis of microglial cells via distinct pathways. Furthermore, TLR7 mRNA expression is down-regulated by TLR2 and TLR7 activation. PMID: 27554518
results provide evidence that G, dG, 8-OHG and 8-OHdG are novel endogenous ligands for TLR7. PMID: 26489884
Virus infection activates endosomal NOX2 oxidase and restricts TLR7 signaling, and that an endosomal NOX2 inhibitor decreases viral pathogenicity. PMID: 28701733
TLR7 deficiency attenuates retinal damage in diabetic retinopathy model. PMID: 28843858
The data demonstrate that an atypical TLR7 signaling pathway contributes to type interferon-beta expression during Y. pestis infection and suggest that the TLR7-driven type I IFN response plays an important role in determining the outcome of plague. PMID: 28847850
Evaluation of the adjuvant effect of agonists of toll-like receptor 4 and 7/8 in a vaccine against leishmaniasis PMID: 28963929
these data demonstrate that extracellular-miRNA mimics (miR-34a, -122, -133a, -142, -146a, and -208a) are potent innate immune activators and that the miRNAs most likely induce cytokine production and leukocyte migration through TLR7 signaling PMID: 28768728
study demonstrates that activation of TLR7 signaling in T cells can inhibit Th17 cell differentiation from naive T cells and IL-17 production in established Th17 cells; further report that downregulation of STAT3 signaling is responsible for TLR7-mediated inhibition of Th17 cells due to induction of suppressor of cytokine signaling 3 and 5 PMID: 28652396
identification of a novel mechanism by which TLR and type I IFN synergize to promote monocyte/macrophage development from hematopoietic progenitors, a process critical in triggering rapid immune responses during infection PMID: 27566824
Notch1-Hes-1 signaling controls TLR7-induced autophagic death of macrophage via regulation of P62 in mice with lupus. PMID: 27537524
Dual TLR2/TLR7 agonist induced the maturation of dendritic cells and primed substantial populations of cytolytic and highly polyfunctional effector CD8(+) T cells in vitro, and safely potentiated the immunogenic properties of a nanoparticulate Ag in vivo, eliciting humoral responses with a balanced TH1/TH2 profile in mice. PMID: 28432147
determine the effects of a loss of autophagy in dendritic cells (DCs), as well as both B cells and DCs, in a TLR7-mediated model of autoimmunity, similar to systemic lupus erythematosus, where both cell types are critical for disease PMID: 28031336
findings show that TLR7 activation significantly promoted interphotoreceptor retinoid-binding protein (IRBP)-specific Th17 responses by upregulating RORgammat, IL-17, GM-CSF, and IL-23R expression in experimental autoimmune uveitis mice. PMID: 27798152
CD72 appears to specifically inhibit B cell response to the endogenous TLR7 ligand Sm/RNP. PMID: 27810925
TLR8 coupling with SOCS-1 inhibits TLR7-mediated antiviral immunity during WNV infection in mice. PMID: 27798161
Azithromycin impairs imiquimod-induced dendritic cell activation by decreasing lysosomal acidification and disrupting TLR7 maturation and signaling. PMID: 27449383
the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID: 26144250
this study demonstrates the critical role of Gfi1 in the regulation of myeloid cells, and prevention of spontaneous lupus autoimmunity by negatively controlling TLR7 signaling PMID: 27600904
this study shows that beta,beta-dimethylacryloyl alkannin could inhibit psoriasis-activated dendritic cells via the TLR7/8 pathway PMID: 27697724
Orally administered R848 triggers TLR-7 on CD11c(+) dendritic cells, inducing interleukin-23 (IL-23) expression followed by a burst of IL-22 secretion by innate lymphoid cells, leading to Reg3gamma expression and restoration of colonization resistance against vancomycin-resistant enterococcus. PMID: 26912904
Aging Impairs the Ability of Conventional Dendritic Cells to Cross-Prime CD8+ T Cells upon Stimulation with a TLR7 Ligand. PMID: 26474053
Type I Interferons maintain expression of TLR7 in B cells and conventional dendritic cells in different ways; total amount of TLR7 is kept in B cells and TLR7(+) population is retained among conventional dendritic cells. PMID: 26621862
These data provide direct evidence that B cells require TLR7-dependent priming through an autophagy-dependent mechanism before autoimmunity is induced, thereafter involving many cell types. PMID: 26120731
describe novel roles for type I IFN and TLR7 signaling in nonhematopoietic cells PMID: 26289159
Data show that preconditioning with poly(I:C) alters toll-like receptors (TLR) and RIG-I-like receptors (RLRs) responses in opposite directions. PMID: 26392465
Report chemical conjugation of TLR7 agonist T7 and multi-repeat-epitope of monoclonal gastric cancer 7 antigen exerts antitumor effects. PMID: 26185376
Our data show that TLR7 excess influences the selection, expansion and diversification of B cells in the germinal center, independent of other genes in the Yaa locus. PMID: 25794167
an important role of 2'-O-methylation for shaping differential TLR7 or TLR8 activation PMID: 25785446
Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling. PMID: 26363072
B-cell intrinsic TLR7 signals promote depletion of the marginal zone in a murine model of Wiskott-Aldrich syndrome. PMID: 26256668
A mucolipin agonist specifically enhanced TLR7 responses to ssRNAs. PMID: 25239130
These studies identify that TLR7 stimulation leads to the expansion of IL-10-producing CD19(+) CD1d(hi) B cells, which can suppress allergic lung inflammation via T regulatory cells. PMID: 25763771
Treatment with Let7c and miR21 restricted dendritic growth of wild-type neurons but not Tlr7(-/-) neurons PMID: 25917529
activation exacerbated lupus nephritis through dendritic and t-regulatory cells PMID: 25341693
TLR8 deletion accelerated autoimmunity in lupus-prone mice in response to TLR7 activation. PMID: 25424423
Inhibition of IDO could enhance the therapeutic efficacy of TLR7 agonists via the increase of T helper type 1 immune response in tumors. PMID: 25322876
Study demonstrates for the first time that influenza A virus and TLR7 activation enhance the NOX2 oxidase-dependent oxidative burst in macrophages. PMID: 24869957
This work identifies signalling through TLR7 as a source of pathology in experimental cerebral malaria. PMID: 25192715
Results suggest that the TLR7 response following Japanese encephalitis virus infection promotes type-1 interferon production and generation of antiviral state which might contribute to protective effect in systemic infection PMID: 24909816
A single copy of TLR7 in B cells is the minimal requirement for breaking the germinal center-tolerance checkpoint. PMID: 25252960
TLR7 activation led to myd88-dependent production of pro-inflammatory cytokines in dystrophin-deficient muscle cells. PMID: 24368419

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.