Recombinant Mouse Tissue Factor Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10132P
Recombinant Mouse Tissue Factor Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10132P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P20352 |
Synonym | CD142 CD142 antigen Coagulation factor III Coagulation factor III (thromboplastin tissue factor) F3 FLJ17960 TF TF_HUMAN TFA Thromboplastin Tissue factor |
Description | Recombinant Mouse Tissue Factor Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | ADPAGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKC FSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPP FTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTL RQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMI FSRKTNQNSPGSSTVCTEQWKSFLGEHHHHHH |
Molecular Weight | 26 kDa |
Purity | >95% SDS-PAGE.Purified by using conventional chromatography techniques. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |