Recombinant Mouse TEM8/ATR Protein
Beta LifeScience
SKU/CAT #: BLA-10114P
Recombinant Mouse TEM8/ATR Protein
Beta LifeScience
SKU/CAT #: BLA-10114P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9CZ52 |
Synonym | Anthrax toxin receptor 1 ANTR1_HUMAN Antxr1 ATR Tumor endothelial marker 8 |
Description | Recombinant Mouse TEM8/ATR Protein was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | EDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHRFISPQLRMSF IVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIY YENSQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKD FNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTIC AGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFAVEDTYLLCP APILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGS |
Molecular Weight | 36 kDa including tags |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium membrane; Single-pass type I membrane protein. Cell projection, filopodium membrane; Single-pass type I membrane protein. |
Protein Families | ATR family |
Database References |
Gene Functions References
- Anthrax Toxin Protective Antigen Variants That Selectively Utilize either the CMG2 or TEM8 Receptors for Cellular Uptake and Tumor Targeting. PMID: 27555325
- An essential physiologic role for Antxr1 in arteriogenesis and peripheral artery disease. PMID: 26785120
- Data demonstrate that TEM8 is an essential regulator of connective tissue homeostasis. it controls synthesis of major matrix components in both endothelial and fibroblastic cells and regulates signaling pathways and matrix degradation. PMID: 25572963
- Anthrax toxin receptors in mouse and human macrophages were silenced using targeted siRNAs or blocked with specific antibody prior to challenge with anthrax lethal toxin. PMID: 24742682
- These results strongly suggest that TEM8 is the only minor anthrax toxin receptor mediating direct lethality in vivo and that other proteins implicated as receptors do not play this role. PMID: 23271637
- This is the first demonstration that the ATR/TEM8 protein is highly expressed in epithelial cells, suggesting that the ATR/TEM8 expression pattern is highly relevant for understanding the pathogenesis of anthrax infection. PMID: 15689409
- The mRNA transcripts of both receptors, ANTXR1 and ANTXR2 were detected in J774A.1 cells and mouse tissues suggesting that anthrax edema toxin and B. anthracis Sterne spore are involved in the ANTXR mRNA regulation in host cells. PMID: 17459655
- Data show that the lethality of anthrax toxin for mice is mostly mediated by CMG2 and that TEM8 plays only a minor role. PMID: 19617532
- Host-derived TEM8 promotes the growth of certain tumors. PMID: 19622764