Recombinant Mouse RSPO1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10079P
Recombinant Mouse RSPO1 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-10079P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9Z132 |
Synonym | CRISTIN3 FLJ40906 hRspo1 R spondin homolog R spondin homolog (Xenopus laevis) R spondin1 R-spondin-1 Roof plate specific spondin Roof plate-specific spondin-1 RP11-566C13.1 RSPO Rspo1 RSPO1_HUMAN |
Description | Recombinant Mouse RSPO1 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | ADPSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERN DIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCQEG LYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCG FRKGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQ GRRENANRHPARKNSKEPGSNSRRHKGQQQPQPGTTGPLTSVGPTWAQHH HHHH |
Molecular Weight | 28 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |