Recombinant Mouse Protective Protein/Cathepsin A (PPCA) (His tag)
Beta LifeScience
SKU/CAT #: BLA-10042P
Recombinant Mouse Protective Protein/Cathepsin A (PPCA) (His tag)
Beta LifeScience
SKU/CAT #: BLA-10042P
Collections: Enzymes, Protease, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P16675 |
Synonym | beta galactosidase 2 BETA GALACTOSIDASE PROTECTIVE PROTEIN beta-galactosidase 2 beta-galactosidase protective protein betagalactosidase 2 Carboxypeptidase C Carboxypeptidase L carboxypeptidase Y-like kininase Cathepsin A Ctsa deamidase EC 3.4.16.5 Glactosialidosis GLB2 Goldberg Syndrome GSL lysosomal carboxypeptidase A Lysosomal protective protein Lysosomal protective protein 20 kDa chain Lysosomal protective protein deficiency NEURAMINIDASE BETA GALACTOSIDASE EXPRESSION; NGBE Neuraminidase deficiency with beta-galactosidase deficiency NGBE OTTHUMP00000031778 OTTHUMP00000031781 PPCA PPCA deficiency PPGB PPGB_HUMAN Protective protein cathepsin A Protective protein for beta galactosidase Protective protein for beta-galactosidase Protective protein/cathepsin A deficiency urinary kininase |
Description | Recombinant Mouse Protective Protein/Cathepsin A (PPCA) (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPV VLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIES PAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGES YAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLL GNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLY APCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDP PCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNS QYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVD YGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEP YVEHHHHHH |
Molecular Weight | 52 kDa including tags |
Purity | >90% purity as determined by SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |