Recombinant Mouse PLBD2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10027P
Recombinant Mouse PLBD2 Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10027P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q3TCN2 |
Synonym | 76 kDa protein LAMA-like protein 2 Lamina ancestor homolog 2 p76 Phospholipase B domain-containing protein 2 Plbd2 PLBL2_HUMAN Putative phospholipase B-like 2 45 kDa form |
Description | Recombinant Mouse PLBD2 Protein (Tagged) was expressed in Mammalian. It is a Full length protein |
Source | Mammalian |
AA Sequence | LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTN AIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNY CGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKG LEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGS GSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPL VAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQG CVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGP SPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQ ALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSL CEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLA KYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD |
Molecular Weight | 65 kDa |
Purity | >90% by SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Putative phospholipase. |
Subcellular Location | Lysosome lumen. |
Protein Families | Phospholipase B-like family |
Database References | |
Tissue Specificity | Present at highest levels in spleen, lung and brain (at protein level). |
Gene Functions References
- A 22-atom substructure of 21 intrinsic S atoms & 1 Xe atom with very low occupancy was found & refined at a resolution of 2.4A. The model was refined to an R(free) factor of 19.8%. The contribution of the Xe atom to the anomalous signal was negligible. PMID: 19237744