Recombinant Mouse Phospholipase A2 activator Protein (PLAP) (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10019P
Recombinant Mouse Phospholipase A2 activator Protein (PLAP) (Tagged)
Beta LifeScience
SKU/CAT #: BLA-10019P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P27612 |
Synonym | FLJ11281 FLJ12699 Glycerophosphatase OTTHUMP00000045176 Phospholipase A 2 activating protein Phospholipase A-2-activating protein Phospholipase A2 activating protein PLA2P Plaa PLAP PLAP_HUMAN |
Description | Recombinant Mouse Phospholipase A2 activator Protein (PLAP) (Tagged) was expressed in Mammalian. It is a Protein fragment |
Source | Mammalian |
AA Sequence | TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFD QANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC |
Molecular Weight | 87 kDa |
Purity | >85% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha (TNF-alpha)- or lipopolysaccharide (LPS)-dependent manner, and hence prostaglandin E2 biosynthesis. |
Subcellular Location | Nucleus. Cytoplasm. Cell junction, synapse. |
Protein Families | WD repeat PLAP family |
Database References | |
Tissue Specificity | Expressed in the brain, with highest levels in hippocampal neurons, cerebellar granular cell layer and Purkinje cells. |
Gene Functions References
- We demonstrate that PLAA is essential for neural function, through dual roles of (1) regulating post-endocytic trafficking of signaling receptors necessary for neural development and (2) directing sorting of synaptic vesicle (SV) components during recycling, essential for synaptic function. PMID: 28413018
- miR-203 may regulate expression of the novel nociceptive mediator PLAA after incision. PMID: 22846677
- Phospholipase A2 activating protein is required for 1alpha,25-dihydroxyvitamin D3 dependent rapid activation of protein kinase C via Pdia3 PMID: 22484374