Recombinant Mouse PDE7A/HCP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10007P
Recombinant Mouse PDE7A/HCP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10007P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P70453-2 |
Synonym | 5''-cyclic phosphodiesterase 7A HCP 1 HCP1 High affinity cAMP specific 3'5' cyclic phosphodiesterase 7A High affinity cAMP-specific 3'' P2A PDE 7 PDE 7A PDE1/PDE2 yeast human complement of PDE7 PDE71 PDE7A PDE7A_HUMAN Phosphodiesterase 7A Phosphodiesterase isozyme 7 Phosphodiesterase7A Rolipram insensitive phosphodiesterase type 7 TM 22 TM22 |
Description | Recombinant Mouse PDE7A/HCP1 Protein was expressed in Baculovirus infected Sf9 cells. It is a Protein fragment |
Source | Baculovirus infected Sf9 cells |
AA Sequence | MLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRR FLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSL IAAATHDLDHPGVNQPFLIKTNHYLATLYKNSSVLENHHWRSAVGLLRES GLFSHLPLESRQEMEAQIGALILATDISRQNEYLSLFRSHLDKGDLHLDD GRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHL GVSPLCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGL NKASWKGLQRQQPSSEDANAAFELNSQLLTQENRLS |
Molecular Weight | 65 kDa including tags |
Purity | >22% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Specific Activity: -‰¥120 pmol/min/µg.Unit |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle. |