Recombinant Mouse PD-L1 Protein (Fc Tag) (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10721P
Recombinant Mouse PD-L1 Protein (Fc Tag) (Biotin)
Beta LifeScience
SKU/CAT #: BLA-10721P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9EP73 |
Synonym | B7 H B7 H1 B7 homolog 1 B7-H1 B7H B7H1 CD 274 CD274 CD274 antigen CD274 molecule MGC142294 MGC142296 OTTHUMP00000021029 PD L1 PD-L1 PD1L1_HUMAN PDCD1 ligand 1 PDCD1L1 PDCD1LG1 PDL 1 PDL1 Programmed cell death 1 ligand 1 Programmed death ligand 1 RGD1566211 |
Description | Recombinant Mouse PD-L1 Protein (Fc Tag) (Biotin) was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | AFTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEKEDEQVIQF VAGEEDLKPQHSNFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCIIS YGGADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWT NSDHQPVSGKRSVTTSRTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQ NHTAELIIPELPATHPPQNRT |
Molecular Weight | 54 kDa including tags |
Purity | >90% SDS-PAGE.>90% purity as measured by gel filtration. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle. |