Recombinant Mouse IL5RA Protein
Beta LifeScience
SKU/CAT #: BLA-0690P
Recombinant Mouse IL5RA Protein
Beta LifeScience
SKU/CAT #: BLA-0690P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | P21183 |
Synonym | CD125 CD125 antigen CDw125 HSIL5R3 IL-5 receptor subunit alpha IL-5R subunit alpha IL-5R-alpha IL-5RA IL5R IL5RA IL5RA_HUMAN Interleukin 5 Receptor alpha Interleukin 5 Receptor alpha chain Interleukin 5 receptor alpha subunit Interleukin 5 receptor subunit alpha Interleukin 5 receptor type 3 Interleukin-5 receptor subunit alpha MGC26560 |
Description | Recombinant Mouse IL5RA Protein was expressed in Baculovirus infected insect cells. It is a Protein fragment |
Source | Baculovirus infected insect cells |
AA Sequence | DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKIN APQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKA PPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYF LYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSK RAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCF NYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPG RWGEWSQPIYVGKERKSLVEWHLEHHHHHH |
Molecular Weight | 38 kDa |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |