Recombinant Mouse IL21R Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0534P
Recombinant Mouse IL21R Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0534P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Mouse |
Accession | Q9JHX3 |
Synonym | CD360 IL 21R IL-21 receptor IL-21R IL21 receptor IL21R IL21R_HUMAN Interleukin 21 receptor Interleukin-21 receptor MGC10967 NILR Novel interleukin receptor |
Description | Recombinant Mouse IL21R Protein (Fc Tag Active) was expressed in CHO cells. It is a Protein fragment |
Source | CHO cells |
AA Sequence | CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHR SGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIK PAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAV RPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSD PVIFQTQAGEPEAGW |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Shows the biological function of the IL-21R moiety and exerts a prolonged circulating half-life caused by the modified Fc domain. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. |