Recombinant Mouse IL2 Receptor beta/p75 Protein (His tag)

Collections: Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P16297
Synonym	CD122 CD122 antigen High affinity IL 2 receptor beta subunit High affinity IL 2 receptor subunit beta High affinity IL-2 receptor subunit beta IL-2 receptor subunit beta IL-2R subunit beta IL-2RB IL15RB IL2 receptor IL2RB IL2RB_HUMAN Interleukin 2 receptor beta Interleukin-2 receptor subunit beta P70 75 P70-75 P7075 p75
Description	Recombinant Mouse IL2 Receptor beta/p75 Protein (His tag) was expressed in Yeast. It is a Protein fragment
Source	Yeast
AA Sequence	AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCEL TLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFH PFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLG HSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQ PLTFRTRPADPMKE
Molecular Weight	27 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Cell surface.
Protein Families	Type I cytokine receptor family, Type 4 subfamily
Database References	KEGG: mmu:16185 STRING: 10090.ENSMUSP00000086820 UniGene: Mm.35287

Gene Functions References

The larger pool of IL-2Rbeta chains in CD8+ T cells is required to sustain IL-2 signaling and contributes to the quantitatively greater proliferative response to IL-2 relative to that of CD4+ mouse primary T cell cultures. PMID: 29259099
Diabetes was accelerated in male and female NOD mice in which IL-2Rbeta signaling was modestly and selectively reduced in T cells. PMID: 29259102
c-REL, but not IkappaBNS, controlled the generation of classical CD25(+)Foxp3(-) precursors via direct binding to the Cd25 locus; propose that CD4(+)GITR(+)CD122(+)CD25(-)Foxp3(-) cells represent a Treg pre-precursor population, whose transition into Treg precursors is mediated via c-REL PMID: 28652399
Renal lesions are indeed modulated by intrinsic glomerular cells through the gamma-C/IL-2-beta receptor response, to date classically described only in immune cells. PMID: 28111009
CBP physically associates with the IL-2 receptor beta-chain. CBP, found in the nucleus in resting CTLL-2 cells, relocates to the cytoplasm after IL-2 stimulation in an MEK/ERK pathway-dependent manner. Thus, IL-2-mediated acetylation plays an important role in the modulation of cytokine signaling and T cell fate. PMID: 27799311
IL-2Rbeta-dependent signaling and CD103 functionally cooperate to maintain tolerance in the gut mucosa. PMID: 25527788
Thymic development of CD4+Foxp3+ regulatory T cells (Tregs) is highly dysregulated in IL-2 receptor (2Rbeta)-deficient mice. PMID: 23315074
CDCD11c+B220+CD122+ cells play an important role in xenograft rejection. Their absence in NOG mice may be critical in supporting the successful engraftment of xenotransplants. PMID: 23018460
This study demonstrated that IL-12 signaling plays a complex role during the induction of tolerance as the presence of exogenous IL-12 and the lack of IL-12 signaling both prevent complete induction of tolerance. PMID: 22522341
Continuous activation of the CD122/STAT-5 signaling pathway characterize regulatory lineage differentiation in the murine thymus. PMID: 21541329
Knockout mice exhibited deficit in prepulse inhibition of acoustic startle reflex, significant reductions in acoustic startle reactivity, and modest differences in behavior in elevated plus-maze test. (IL-2/15 receptor-beta) PMID: 11864627
role of the interleukin-2 receptor beta chain region between the two Stat5 docking sites in induction of interleukin-2 receptor alpha expression by interleukin-2 PMID: 12231477
Depletion of IL-2 in vivo induces memory CD8+ T cell division by an IL-15-independent but by an IL-2/15 receptor beta-dependent mechanism, implying a novel process for antigen-independent homeostasis of memory CD8+ T cells in vivo. PMID: 15528339
This study for the first time delineates the molecular mechanisms underlying regulation of mouse IL-2Rbeta gene transcription by Ets family proteins, partially with Egr-1, and thereby further elucidates the molecular basis of lymphocyte activation. PMID: 15752766
The multivesicular regions were present in the cap structure of these granules, suggesting that the uNK cells of the Tg2Rbeta mice had cytotoxic activity. PMID: 16127247
these cells make up a specialized subset of central memory T cells with distinguishable phenotypic characteristics, most notably the higher expression of CD122 and CD127 PMID: 16920913
STAT5 binds to the promoter of the foxp3 gene suggesting that IL-2Rbeta-dependent STAT5 activation promotes Treg differentiation by regulating expression of foxp3. PMID: 17182565
a signal mediated by IL-2Rbeta is essential for the development and homeostasis of Foxp3(+) Treg in vivo PMID: 17559173
local blockade of the beta-chain of the IL-2R restored an immunosuppressive cytokine milieu in the lung that ameliorated both inflammation and airway hyperresponsiveness in experimental allergic asthma PMID: 18641329
Common gamma-chain binding-dependent activation of the shared IL-15/IL-2 receptor beta/common gamma signaling pathway may play an important role in the activation of natural killer (NK) cells and CD8-positive T cells, resulting in tumor growth inhibition. PMID: 19050240
IL-9Ralpha and IL-2Rbeta homodimers efficiently mediate constitutive activation of ALL-associated JAK1 mutants. PMID: 19139102
subset of IL-2-dependent targets is indexed to a low IL-2R signaling threshold PMID: 19185518
A population of memory CD8 T cells generated under sterile inflammatory conditions is identified by intermediate expression levels of CD122/CD44 and is involved in recall contact hypersensitivity reactions responsible for allergic contact dermatitis. PMID: 19265164
IL2R beta-chain induces growth potential for glandular epithelial cells and an immune-privileged condition mediated by CD25+regulatory-T cells. PMID: 19293560

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.