Recombinant Mouse Fc epsilon RI/FCER1A Protein (Tagged)

Collections: Fc receptors, Featured fc receptors molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Mouse
Accession	P20489
Synonym	Fc epsilon RI alpha Fc epsilon RI alpha chain Fc epsilon RI alpha-chain Fc fragment of IgE high affinity I receptor for alpha polypeptide Fc fragment of IgE, high affinity I, receptor for, alpha subunit Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide Fc IgE receptor alpha polypeptide Fc IgE receptor, alpha chain Fc IgE receptor, alpha polypeptide Fc of IgE high affinity I receptor for alpha polypeptide Fc-epsilon RI-alpha FCE 1A FCE1A FCER 1A Fcer1a FCERA_HUMAN FcERI FceRI alpha high affinity IgE receptor High affinity immunoglobulin epsilon receptor alpha subunit high affinity immunoglobulin epsilon receptor alpha-subunit High affinity immunoglobulin epsilon receptor subunit alpha IgE Fc receptor alpha subunit IgE Fc receptor subunit alpha Immunoglobulin E receptor high affinity of mast cells alpha polypeptide immunoglobulin E receptor, high-affinity, of mast cells, alpha polypeptide
Description	Recombinant Mouse Fc epsilon RI/FCER1A Protein (Tagged) was expressed in Cell free. It is a Full length protein
Source	Cell free
AA Sequence	ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVN SSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLV HGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYH CKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLL STEEQFKSVLEIQKTGKYKKVETELLT
Molecular Weight	45 kDa including tags
Purity	>90% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.