Recombinant Major pollen allergen Lol p 5a Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9823P
Recombinant Major pollen allergen Lol p 5a Protein (Tagged)
Beta LifeScience
SKU/CAT #: BLA-9823P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Lolium perenne |
Accession | Q40240 |
Synonym | Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a LOLPIB |
Description | Recombinant Major pollen allergen Lol p 5a Protein (Tagged) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAA NAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEA TPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVD KIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSL EAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATA AATVATAAATAAAVLPPPLLVVQSLISLLIYY |
Molecular Weight | 48 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Subcellular Location | Note=Starch granule. |
Protein Families | Poa p IX/Phl p VI allergen family |
Tissue Specificity | Pollen, starch granules. |