Recombinant Leiurus quinquestriatus Alpha-insect toxin LqhaIT Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9808P
Recombinant Leiurus quinquestriatus Alpha-insect toxin LqhaIT Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-9808P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Leiurus quinquestriatus |
Accession | P17728 |
Description | Recombinant Leiurus quinquestriatus Alpha-insect toxin LqhaIT Protein (His tag) was expressed in E.coli. It is a Full length protein |
Source | E.coli |
AA Sequence | VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYA LPDNVPIRVPGKCHRK |
Molecular Weight | 24 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice. |
Subcellular Location | Secreted. |
Protein Families | Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily |
Tissue Specificity | Expressed by the venom gland. |