USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant Influenza B Virus Nucleoprotein (His tag)

Cat No.: BLA-11457P
Description Related products
host species Influenza B
accession P04665
synonym Influenza B Virus NP NP Nucleocapsid protein Nucleoprotein Protein N
description Recombinant Influenza B Virus Nucleoprotein (His tag) was expressed in Yeast. It is a Full length protein
source Yeast
AA sequence MSNMDIDSINTGTIDKTPEELTPGTSGATRPIIKPATLAPPSNKRTRNPS PERTTTSSETDIGRKIQKKQTPTEIKKSVYKMVVKLGEFYNQMMVKAGLN DDMERNLIQNAQAVERILLAATDDKKTEYQKKRNARDVKEGKEEIDHNKT GGTFYKMVRDDKTIYFSPIKITFLKEEVKTMYKTTMGSDGFSGLNHIMIG HSQMNDVCFQRSKGLKRVGLDPSLISTFAGSTLPRRSGTTGVAIKGGGTL VDEAIRFIGRAMADRGLLRDIKAKTAYEKILLNLKNKCSAPQQKALVDQV IGSRNPGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNTE EYSMVGYEAMALYNMATPVSILRMGDDAKDKSQLFFMSCFGAAYEDLRVL SALTGTEFKPRSALKCKGFHVPAKEQVEGMGAALMSIKLQFWAPMTRSGG NEVSGEGGSGQISCSPVFAVERPIALSKQAVRRMLSMNVEGRDADVKGNL LKMMNDSMAKKTSGNAFIGKKMFQISDKNKVNPIEIPIKQTIPNFFFGRD TAEDYDDLDY
molecular weight 64 kDa including tags
purity >90% SDS-PAGE.
endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
formulation Liquid Solution
stability The recombinant protein samples are stable for up to 12 months at -80℃
reconstitution See related COA
unit definition For Research Use Only
storage buffer Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Cat No. Product Name Source Detail Inquiry
BLA-11456P Recombinant Influenza B Virus Hemagglutinin Protein (His tag) HEK293
BLA-11458P Recombinant Influenza B Virus Nucleoprotein (Tagged) E.coli
BLA-11459P Recombinant Influenza B/Jilin/20/2003 Protein Baculovirus infected insect cells
BLA-11460P Recombinant Influenza B/Ohio/01/05 Protein Baculovirus infected insect cells
BLIT-0932 Recombinant Influenza B Florida Egg
BLIT-0933 Recombinant Influenza B Florida Egg
BLIT-0936 Recombinant Influenza B Malaysia Egg
BLIT-0938 Recombinant Influenza B Qingdao Egg
BLIT-0939 Recombinant Influenza B Tokio Egg
BLIT-0940 Recombinant Influenza B Victoria Egg
BLPSN-5406 Recombinant Influenza B (B/Brisbane/3/2007) Hemagglutinin / HA1 Protein (His Tag) HEK293
BLPSN-5408 Recombinant Influenza B (B/Brisbane/60/2008) Hemagglutinin / HA Protein (His Tag) HEK293
BLPSN-5409 Recombinant Influenza B (B/Brisbane/60/2008) Hemagglutinin Protein (HA1 Subunit) (His Tag) HEK293
BLPSN-5410 Recombinant Influenza B (B/Florida/07/2004) Hemagglutinin / HA1 Protein (His Tag) HEK293
BLPSN-5411 Recombinant Influenza B (B/Florida/4/2006) Hemagglutinin Protein (HA2 Subunit) (Fc Tag) HEK293
BLPSN-5412 Recombinant Influenza B (B/Florida/4/2006) Hemagglutinin Protein (HA2 Subunit) (Fc Tag) HEK293
BLPSN-5414 Recombinant Influenza B (B/Hong Kong/05/1972) Hemagglutinin / HA1 Protein (His Tag) HEK293
BLPSN-5416 Recombinant Influenza B (B/Malaysia/2506/2004) Hemagglutinin / HA Protein (His Tag) HEK293
BLPSN-5417 Recombinant Influenza B (B/Malaysia/2506/2004) Hemagglutinin Protein (HA1 Subunit) (His Tag) HEK293
BLPSN-5420 Recombinant Influenza B (B/Massachusetts/03/2010) Hemagglutinin Protein (HA1 Subunit) (His Tag) HEK293
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon