USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Egypt/N03072/2010

Cat No.: BLA-11431P
Description Related products
accession ADG21447
description Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Egypt/N03072/2010 was expressed in HEK293. It is a Protein fragment
source HEK293
AA sequence QICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCNLDGVKPLI LRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEEL KHLLSRINHFEKIQIIPKSSWSDHEASGVSSXCPYQGRSSFFRNVVWLTK KDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGT STLNQRLVPKIATRSKVNGQSGRMEFFWTILKSNDAINFESNGNFIAPEN AYKIVKKGDSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGEC PKYVKSNRLVLATGLRNSPQGERRRKKR
molecular weight 37 kDa
purity >95% SDS-PAGE.
endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
formulation Liquid Solution
stability The recombinant protein samples are stable for up to 12 months at -80℃
reconstitution See related COA
unit definition For Research Use Only
storage buffer Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.
Cat No. Product Name Source Detail Inquiry
BLA-11417P Recombinant Avian Influenza A Hemagglutinin Protein HEK293
BLA-11418P Recombinant Influenza A Avian Influenza A Neuraminidase Protein (His tag) HEK293
BLA-11419P Recombinant Influenza A H3 (H3N2) Protein Baculovirus infected BTI-TN-5B1-4 cells
BLA-11420P Recombinant Influenza A HA1 (H9N2) Protein Baculovirus infected insect cells
BLA-11421P Recombinant Influenza A HA1 (H9N2) Protein (His tag) HEK293
BLA-11422P Recombinant Influenza A HA1(H5N1) Protein (His tag) HEK293
BLA-11423P Recombinant Influenza A Hemagglutin HA1 Protein Baculovirus infected BTI-TN-5B1-4 cells
BLA-11424P Recombinant Influenza A Hemagglutinin Protein Baculovirus infected Sf9 cells
BLA-11425P Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Perth/16/09 HEK293
BLA-11426P Recombinant Influenza A Hemagglutinin Protein (BSA and azide free) HEK293
BLA-11427P Recombinant Influenza A Hemagglutinin Protein HEK293
BLA-11428P Recombinant Influenza A Hemagglutinin Protein (His tag) E.coli
BLA-11429P Recombinant Influenza A Hemagglutinin Protein (His tag) (His tag) Strain Egypt/N03072/2010 HEK293
BLA-11430P Recombinant Influenza A Hemagglutinin Protein (His tag) Strain California/07/2009/H1N1 HEK293
BLA-11432P Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Hong Kong/33982/2009 HEK293
BLA-11433P Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Hong Kong/33982/2009 HEK293
BLA-11434P Recombinant Influenza A Hemagglutinin Protein (His tag) Strain Hubei/1/2010 HEK293
BLA-11435P Recombinant Influenza A Influenza A Virus Nucleoprotein (His tag) E.coli
BLA-11436P Recombinant Influenza A Non-structural Protein 1 (His tag) E.coli
BLA-11437P Recombinant Influenza A Nucleoprotein (His tag) E.coli
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon