Recombinant Human YAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10497P
Recombinant Human YAP1 Protein
Beta LifeScience
SKU/CAT #: BLA-10497P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | 65 kDa Yes associated protein 65 kDa Yes-associated protein COB1 YAP YAp 1 YAP 65 YAP-1 YAP1 YAP1_HUMAN YAP2 YAP65 yes -associated protein delta Yes associated protein 1 Yes associated protein 1 65kDa Yes associated protein 2 yes associated protein beta YKI Yorkie homolog |
Description | Recombinant Human YAP1 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPK SHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPA ATPTAQHLR |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |