Recombinant Human SEPT7/SEPTIN7 Protein
Beta LifeScience
SKU/CAT #: BLA-0005P
Recombinant Human SEPT7/SEPTIN7 Protein
Beta LifeScience
SKU/CAT #: BLA-0005P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q16181 |
Synonym | CDC10 CDC10 protein homolog CDC3 Cell division cycle 10 NBLA02942 SEPT7 SEPT7_HUMAN SEPT7A Septin 7 Septin-7 |
Description | Recombinant Human SEPT7/SEPTIN7 Protein was expressed in Wheat germ. It is a Full length protein |
Source | Wheat germ |
AA Sequence | MVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINS LFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGD AVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSG HGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHK IKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPW GVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTY NGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKV QKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILE QQNSSRTLEKNKKKGKIF |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |
Target Details
Target Function | Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Required for normal progress through mitosis. Involved in cytokinesis. Required for normal association of CENPE with the kinetochore. Plays a role in ciliogenesis and collective cell movements. Forms a filamentous structure with SEPTIN12, SEPTIN6, SEPTIN2 and probably SEPTIN4 at the sperm annulus which is required for the structural integrity and motility of the sperm tail during postmeiotic differentiation. |
Subcellular Location | Cytoplasm. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Cleavage furrow. Midbody. Cytoplasm, cytoskeleton, cilium axoneme. Cell projection, cilium, flagellum. |
Protein Families | TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, Septin GTPase family |
Database References | |
Tissue Specificity | Widely expressed. |
Gene Functions References
- The present study identified that SEPT7 was a potential target of miR5903p and demonstrated that SEPT7 is associated with mediating the proapoptotic effect of miR5903p in human osteoblast cell line hFOB 1.19. PMID: 29568931
- SEPT7 overexpression and knockdown sept7 protein suppress the expression of 78 kDa glucoseregulated protein (GRP78), C/EBPhomologous protein (CHOP), pro-caspase3 and cleaved caspase3 and eIf 2alpha protein. PMID: 29344665
- Study discloses both SEPT2 and SEPT7 are essential for breast cancer cell migration and invasion by controlling MEK/ERK MAPKs activation. PMID: 27557506
- SUMOylation of human septins is critical for septin filament bundling and cytokinesis. PMID: 29051266
- Low SEPT7 expression is associated with glioma cell invasion. PMID: 27006177
- The results of this study found that bipolar Neural crest cells progenitors lose their polarity, retracting their processes to round for division, but generate neurons with bipolar morphology by emitting processes from the same locations as the progenitor. PMID: 28817802
- Results show that SEPT7 is involved in glioma cell migration with the assistance of cofilin phosphomediated cytoskeleton locomotion. PMID: 26846171
- Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis PMID: 25380047
- Significantly lower SEPT7 expression in all expressional categories in encapsulated papillary thyroid carcinoma, follicular variant group may be a sign of different molecular signature in this type of tissue. PMID: 24685401
- In response to Candida albicans infection, SEPT7 forms a complex with endothelial cell N-cadherin, is required for normal accumulation of N-cadherin around hyphae, and is necessary for maximal fungal endocytosis. PMID: 24345743
- Significantly lower SEPT7 expression in encapsulated follicular variant of papillary thyroid carcinoma may be a sign of different molecular signature in this type of tissue. PMID: 24685401
- SEPT2 forms a 1:1:1 complex with SEPT7 and SEPT9. PMID: 23572511
- miR-30a-5p is a bona fide negative regulator of SEPT7 and the oncogenic activity of miR-30a-5p in human gliomas is at least in part through the repression of SEPT7 PMID: 23383034
- Myeloid K562 cells express three SEPT9 isoforms, all of which have an equal propensity to hetero-oligomerize with SEPT7-containing hexamers to generate octameric heteromers. PMID: 22956766
- Mutagenic analyses revealed that mutation of a potential phosphorylation site in SEPT7 (Y318) regulates the interaction with other septins. PMID: 21767235
- the purification, crystallization and structure for the GTP-binding domain of human septin 7 PMID: 22064074
- Sept7 occupies the ends of hexameric building blocks which assemble into non-polarised filaments. PMID: 21824007
- The SEPT7 provides the directional guidance cues necessary for polarizing the epithelial microtubule network. PMID: 21788367
- Data show that Septins of the SEPT6 group preferentially interacted with septins of the SEPT2 group, SEPT3 group and SEPT7 group. PMID: 21082023
- SEPT7 gene expression is decreased in follicular variant of papillary thyroid carcinoma. PMID: 21509594
- SEPT7 is involved in the regulation of sperm maturation. PMID: 20352323
- The expression of SEPT7 mRNA was significantly decreased by 6.9% in subjects with schizophrenia. PMID: 20385374
- This study demonstrates that SEPT7 is involved in gliomagenesis and suppresses glioma cell growth. PMID: 20035367
- SEPT7 plays an important role in the glioma cell invasion. PMID: 19916744
- regulated but the expression of CDK9, CDC20 and CLK3 was down- regulated in azoospermic testes. PMID: 19426592
- Sept7/9b/11 form a complex that has effects on filament elongation, bundling, or disruption PMID: 15485874
- septin 2, 6, and 7 complexes make up polymerized filaments PMID: 16914550
- crystal structures of the human SEPT2 G domain and the heterotrimeric human SEPT2-SEPT6-SEPT7 complex PMID: 17637674
- Demonstrate connection between septins/SOCS7/NCK signaling and the DNA damage response. PMID: 17803907
- SEPT7 forms a link between kinetochore distribution of CENP-E and the mitotic spindle checkpoint. PMID: 18460473
- SEPT7 gene can inhibit the invasion and migration ability of U251 glioma cells by reversing imbalanced state of MMPs/TIMPs, downregulating expression of integrin alpha(v)beta(3) and altering structure of tubulin-alpha. PMID: 18543212