Recombinant Human RORC Protein
Beta LifeScience
SKU/CAT #: BL-4150PS
Recombinant Human RORC Protein
Beta LifeScience
SKU/CAT #: BL-4150PS
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | Flag |
Host Species | Human |
Synonym | Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA. |
Background | RORC is a DNA-binding transcription factor which belongs to the NR1 subfamily of nuclear hormone receptors. The specific functions of the RORC protein are not known; nevertheless, studies of a similar gene in mice have shown that the RORC gene may be vital for lymphoid organogenesis and may have an imperative regulatory role in thymopoiesis. Furthermore, studies in mice suggest that RORC may inhibit the expression of Fas ligand and IL2. RORC may be a possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. RORC is Crucial for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. RORC is also involved in lineage specification of uncommitted CD4(+) T helper cells into Th17 cells. In addition, RORCs regulate the expression of several components of the circadian clock. |
Description | RAR-Related Orphan Receptor C Human Recombinant expressed in E.Coli is a full length protein consisting of 497a.a. having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag.RORC is purified by unique purification methods. |
Source | E.coli |
AA Sequence | MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEFMRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK. |
Purity | >80.0% as determined by SDS-PAGE. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Formulation | RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5. |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles. |