Recombinant Human MOG Protein
Beta LifeScience
SKU/CAT #: BL-3545PS
Recombinant Human MOG Protein
Beta LifeScience
SKU/CAT #: BL-3545PS
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | His |
Host Species | Human |
Synonym | Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137. |
Background | Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis. |
Description | Myelin Oligodendrocyte Glycoprotein expressed in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132a.a. (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular weight of 15.2 kDa. |
Source | E.coli |
AA Sequence | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH. |
Purity | >95.0% as determined by SDS-PAGE. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Formulation | The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2µm filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |