Recombinant Human LAMP1 Protein
Beta LifeScience
SKU/CAT #: BLA-5253P
Recombinant Human LAMP1 Protein
Beta LifeScience
SKU/CAT #: BLA-5253P
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | P11279 |
Synonym | CD107 antigen like family member A CD107 antigen-like family member A CD107a CD107a antigen LAMP 1 LAMP-1 LAMP1 LAMP1_HUMAN LAMPA LGP120 lgpA Lysosomal membrane glycoprotein 120KD Lysosomal Associated Membrane Protein 1 Lysosome associated membrane glycoprotein 1 Lysosome-associated membrane glycoprotein 1 Lysosome-associated membrane protein 1 OTTHUMP00000040663 |
Description | Recombinant Human LAMP1 Protein was expressed in HEK293. It is a Protein fragment |
Source | HEK293 |
AA Sequence | AMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRS SCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLF PNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAY LSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTN GTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLEL HSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRAL QATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLD ENSMVDHHHHHH |
Molecular Weight | 39 kDa including tags |
Purity | Greater than 95% SDS-PAGE |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |
Target Details
Target Function | Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.; (Microbial infection) Acts as a receptor for Lassa virus glycoprotein. Promotes also fusion of the virus with host membrane in less acidic endosomes.; (Microbial infection) Supports the FURIN-mediated cleavage of mumps virus fusion protein F by interacting with both FURIN and the unprocessed form but not the processed form of the viral protein F. |
Subcellular Location | Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein. |
Protein Families | LAMP family |
Database References |
Gene Functions References
- LIN28A inhibits lysosomeassociated membrane glycoprotein 1 protein expression in embryonic stem and bladder cancer cells. PMID: 29749495
- A novel data on LAMP-1 overexpression in high grade glioma are presented suggesting involvement of this gene and protein in cell adhesion and tumor progression. PMID: 29920782
- LAMP1 is involved in the TNM stages and histological differentiation of the esophageal squamous cell carcinoma PMID: 28687162
- LAMP1 has a role in fratricide amongst T cell receptor transgenic CD8+ T cells directed against tumor-associated antigens PMID: 27447745
- Impaired autophagic pathways were further shown by analyzing late autophagic vesicles; immunostaining with lysosome-associated membrane protein 1 (LAMP-1) antibody revealed enlarged and annular LAMP-1-positive organelles in AMD retinal pigment epithelium (RPE)as opposed to smaller discrete puncta observed in normal RPE PMID: 28055007
- The authors show here that human LAMP1 and LAMP2 bind cholesterol in a manner that buries the cholesterol 3beta-hydroxyl group; they also bind tightly to NPC1 and NPC2 proteins that export cholesterol from lysosomes. PMID: 27664420
- downregulation of FUT1, which leads to the perinuclear localization of LAMP-1 and 2, is correlated with increased rate of autophagic flux by decreasing mTOR signaling and increasing autolysosome formation. PMID: 27560716
- the assembly modes of LAMP-1 and LAMP-2 are different, which may underlie their distinct functions PMID: 27663661
- Overexpression of LAMP1 was observed in prostate cancer (PCa) and castration-resistant prostate cancer clinical specimens. Moreover, downstream pathways were identified using si-LAMP1-transfected cells. The discovery of tumor-suppressive miR320a-mediated pathways may provide important insights into the potential mechanisms of PCa metastasis. PMID: 27212625
- The data implied that high LAMP1 expression is associated with unfavourable prognosis in laryngeal squamous cell carcinoma patients, and LAMP1 may be identified as a novel prognostic biomarker PMID: 27788920
- The data support a viral entry mechanism dependent on binding to the lysosome-resident receptor LAMP1 and further dissociation of the membrane-distal GP1 subunits. PMID: 26849049
- A unique triad of histidines of Lassa Virus GP1 forms a binding site for host LAMP1. PMID: 25972533
- The LAMP-1 had preferential localization in the high density secondary lysosomes where endogenous human LAMP-1 was enriched. In contrast, a major portion of I382L was located in a low density fraction. PMID: 24695761
- Downregulation of miR-184 was consistent with significantly lower levels of LAMP-1 PMID: 25251993
- Synergistic defects of different molecules in the cytotoxic pathway lead to clinical familial hemophagocytic lymphohistiocytosis. PMID: 24916509
- Caveolin-1 associated adenovirus entry into human corneal cells. PMID: 24147000
- study has shown that Lassa virus entry requires a pH-regulated engagement of alpha-DG and LAMP1 both of which need to be glycosylated PMID: 24970085
- in TB pleurisy regulatory T lymphocytes effectively inhibit CD107a expression PMID: 24134738
- LAMP-1 and LAMP-2 could be used as additional markers with which to assess enzyme replacement therapy effectiveness in Fabry disease. PMID: 24334114
- LAMP-1/GFAP showed pronounced co-expression and LAMP-1/CD133 was co-expressed as well in astrocytomas suggesting that tumor cells including the proposed tumor stem cells contain lysosomes. PMID: 23826410
- CD107a/LAMP-1 has a role in the protection of NK cells from degranulation-associated suicide PMID: 23847195
- Data indicate that monoclonal antibodies specific to CD107a (LAMP-1) or CD107b (LAMP-2) enhanced LPS-induced IL-8 secretion of THP-1 cells. PMID: 23603048
- LAMP1 is required for efficient perforin delivery to lytic granules and NK-cell cytotoxicity. PMID: 23632890
- Simultaneous expression of LAMP1 and EGFR correlates with the ovarian neoplasm grading. PMID: 23172893
- LAMP proteins retain TAPL on the limiting membrane of endosomes and prevent its sorting to intraluminal vesicles. PMID: 22641697
- Data indicate that lysosomally targeted cameleon Ca2+ probe LAMP1-YCaM accurately and sensitively responds to both global and lysosome-specific Ca2+ signals. PMID: 23098255
- Report expression of NKG2D and CD107 in CD8(+) effector memory lymphocytes in Churg-Strauss syndrome. PMID: 22640649
- nucleolin and LAMP-1 have a role in promoting infection of human monocytes by Francisella tularensis PMID: 21152024
- Human full-length amelogenin increases the proliferation of mesenchymal stem cells by interaction with LAMP1 through the MAPK-ERK signaling pathway. PMID: 20967466
- Immunohistochemistry studies showed EGBs to exhibit pronounced reactivity to antibodies against lysosome-associated membrane proteins (LAMP)-1 and LAMP-2, and the lysosomal enzyme cathepsin D. PMID: 20926008
- review of structure, function, cell and tissue distribution, intracellular trafficking PMID: 12144129
- This study identifies two cDNA clones that code for heart extracellular matrix protein, hLAMP-1. Immunohistochemical studies indicate that the myocardial layer of the heart produces hLAMP-1. PMID: 15052658
- Using human leukemia and lymphoma cell lines, we observed a close correlation between CD107a surface expression and target cell lysis, indicating that NK cell cytotoxicity can be assessed by this method. PMID: 15744340
- Data identify CD13, CD107a, and CD164 as novel basophil-activation antigens. PMID: 15916720
- Novel evidence for differential expression of HBGA and LAMPs in proliferative and involutive phases of immunohistochemistry is presented. PMID: 16570122
- expression in keratinocytes cultured at different cell densities in order to induce differentiation PMID: 16710742
- Enhanced expression of lysosome-associated membrane protein-1 in melanoma may promote invasion by influencing both adhesion to extracellular matrix and perhaps also binding to endothelial cells. PMID: 16718270
- CD107a surface expression has a role in Munc13-4 defect in familial hemophagocytic lymphohistiocytosis PMID: 16778144
- LAMP-1 and DC-LAMP antigen chimeras follow different trafficking pathways, induce distinct modulatory immune responses, and are able to present cryptic epitopes. PMID: 16887987
- LAMP-1 and LAMP-2 may have roles in accidental involution of the thymic gland PMID: 17048695
- Data show that cells lacking either LAMP-1 or LAMP-2 alone formed phagosomes that gradually acquired microbicidal activity and curtailed bacterial growth, but LAMP-1 and LAMP-2 double-deficient cells failed to kill engulfed Neisseria gonorrhoeae. PMID: 17506821
- CD107a expression may be a sensitive marker for the cytotoxic activity determination PMID: 18835598
- Despite its abundance, LAMP-1 is not essential, but LAMP-2 may be partially important for the Salmonella-containing vacuolar membrane. PMID: 18958159
- the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1 PMID: 19079288
- Most Hassal's corpuscules in thymoma were negative for LAMPs, but positive in normal thymus. Both lymphocytes and epithelial cells in pathological thymus showed higher intensity for LAMP-2 compared with LAMP-1. PMID: 19343823
- Data show that The cell surface expression levels of (ICAM)-2 and -3 on the apoptotic cells were markedly lower, while those of calnexin, calreticulin, and (LAMP)-1 and -2 were significantly higher compared to non-apoptotic cells. PMID: 19524015