Recombinant Human IL3RA/CD123 Protein
Beta LifeScience
SKU/CAT #: BLA-0653P
Recombinant Human IL3RA/CD123 Protein
Beta LifeScience
SKU/CAT #: BLA-0653P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CD123 CD123 antigen hIL 3Ra hIL-3Ra hIL3Ra IL 3 receptor alpha SP2 isoform IL 3R alpha IL-3 receptor subunit alpha IL-3R subunit alpha IL-3R-alpha IL-3RA IL3 Receptor alpha IL3R Il3ra IL3RA_HUMAN IL3RAX IL3RAY IL3RX IL3RY Interleukin 3 receptor alpha chain Interleukin 3 receptor, alpha Interleukin 3 receptor, alpha (low affinity) Interleukin-3 Receptor alpha Interleukin-3 receptor subunit alpha Interleukin3 receptor Interleukin3 receptor, Y-chromosomal |
Description | Recombinant Human IL3RA/CD123 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYC QFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |