Recombinant Human IL34 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0626P
Recombinant Human IL34 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0626P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q6ZMJ4 |
Synonym | C16orf77 Chromosome 16 open reading frame 77 FPT025 IL 34 IL-34 Il34 IL34_HUMAN Interleukin 34 Interleukin-34 Interleukin34 MGC34647 |
Description | Recombinant Human IL34 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein |
Source | Baculovirus infected insect cells |
AA Sequence | ADPNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP YEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWK YLQEVQTLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDN CFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPP WSPSSPPHSTGSVRPVRAQGEGLLPHHHHHH |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |