Recombinant Human IL27-A + EBI3 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0571P
Recombinant Human IL27-A + EBI3 Protein (Fc Tag Active)
Beta LifeScience
SKU/CAT #: BLA-0571P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q8NEV9Q14213 |
Synonym | IL27-A+EBI3 |
Description | Recombinant Human IL27-A + EBI3 Protein (Fc Tag Active) was expressed in CHO cells. It is a Full length protein |
Source | CHO cells |
AA Sequence | VWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSEVRGQAHRFAESHLPG VNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALLGGLGT QGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEE ERKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLS KAGHSVWPLGFPTLSPQP |
Purity | >= 98% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Bioactivity was measured in a cell proliferation assay using anti-CD3 activated human peripheral mononuclear cells. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. |