Recombinant Human IL23 Protein
Beta LifeScience
SKU/CAT #: BLA-0551P
Recombinant Human IL23 Protein
Beta LifeScience
SKU/CAT #: BLA-0551P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q9NPF7 |
Synonym | IL 23 IL 23 A IL 23 subunit alpha IL 23A IL 23p19 IL-23 subunit alpha IL-23-A IL-23p19 IL12B IL23 Il23a IL23A_HUMAN IL23P19 interleukin 12B Interleukin 23 alpha subunit p19 Interleukin 23 p19 subunit interleukin 23 subunit alpha interleukin 23 subunit p19 interleukin six, G CSF related factor Interleukin-23 subunit alpha Interleukin-23 subunit p19 JKA3 induced upon T cell activation MGC79388 P19 SGRF |
Description | Recombinant Human IL23 Protein was expressed in BTI-TN-5B1-4 cells. It is a Full length protein |
Source | BTI-TN-5B1-4 cells |
AA Sequence | RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVP HIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDS PVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSL QAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDT PEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLL LLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDL TFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAA EESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQV EVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRK NASISVRAQDRYYSSSWSEWASVPCS |
Molecular Weight | 54 kDa |
Purity | >95% SDS-PAGE.Purity greater than 95% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Bioactivity | Biological activity measured by the ability to induce IL-17 secretion by mouse splenocytes. |
Formulation | Lyophilised |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. The lyo |