Recombinant Human IL22 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-0539P

Recombinant Human IL22 Protein (His tag)

Beta LifeScience SKU/CAT #: BLA-0539P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession Q9GZX6
Synonym Cytokine Zcyto18 IL 10 related T cell derived inducible factor IL 21 IL 22 IL D110 IL TIF IL-10-related T-cell-derived-inducible factor IL-22 IL-TIF IL21 Il22 IL22_HUMAN ILD110 ILTIF Interleukin 10 related T cell derived inducible factor interleukin 21 Interleukin 22 Interleukin-22 MGC79382 MGC79384 TIFa TIFIL 23 TIFIL23 UNQ3099/PRO10096 zcyto18
Description Recombinant Human IL22 Protein (His tag) was expressed in Baculovirus infected insect cells. It is a Full length protein
Source Baculovirus infected insect cells
AA Sequence ADPAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLF HGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLS TCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIH HHHHH
Molecular Weight 18 kDa including tags
Purity >90% SDS-PAGE.
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Measured by its ability to induce IL-10 secretion using COLO 205 human colorectal adenocarcinoma cell. The ED50 for this effects is less or equal to 1.2 ng/ml.
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Cytokine that contributes to the inflammatory response in vivo.
Subcellular Location Secreted.
Protein Families IL-10 family
Database References

Gene Functions References

  1. these findings show that CD147 is a novel and key mediator of IL-22-induced psoriatic alterations in the epidermis and might be a therapeutic target in patients with psoriasis. PMID: 28272440
  2. we have shown that variants of the IL22 gene may play an important role in the pathogenesis of CM and that these variants of IL22 are associated with an aggravation of malaria. The rs2227473 risk allele for CM, the T allele, is associated with higher levels of IL-22 production, suggesting that IL-22 contributes to CM. PMID: 28139719
  3. This study highlights a mechanism through which the IL-22 pathway facilitates the human intestinal epithelium to control microbial infection. PMID: 30217896
  4. rs1179251 polymorphism may be a risk factor for cancer [meta-analysis] PMID: 29761647
  5. the expression of miR-548a-3p is upregulated in IL-22 mediated keratinocyte proliferative disorder like psoriasis. PMID: 29181737
  6. IL-22 is involved in A549 cell resistance to paclitaxel through regulating cell apoptosis via the JNK signaling pathway. PMID: 29723165
  7. we summarize the current knowledge on the roles of IL-22 in the various pancreatic pathogenesis, providing insights into the underlying cellular and signaling mechanisms--{REVIEW} PMID: 29502986
  8. IL22 is upregulated by atorvastatin, losartan and captopril and its polymorphism may have a role in hypertension and coronary artery disease PMID: 29981321
  9. Increased IL-22 urinary level was not associated with candida urinary tract infection. PMID: 29421775
  10. The level of lncRNA H19 is increased in inflamed intestinal tissues from mice and patients. The inflammatory cytokine IL22 induces expression of H19 in IECs, which is required for intestinal epithelial proliferation and mucosal healing. H19 lncRNA appears to inhibit p53 protein and microRNA 34a and let-7 to promote proliferation of IECs and epithelial regeneration. PMID: 29621481
  11. hidradenitis suppurativa keratinocytes exhibited lower amounts of IL-22 PMID: 28972431
  12. Study shows that in Chinese subjects, the plasma concentration of interleukin-22 (IL-22) is profoundly associated with susceptibility to impaired fasting glucose (IFG) and type 2 diabetes, and decreased plasma IL-22 level is a potential trigger of IFG and type 2 diabetes. PMID: 28170163
  13. effect of IL-22 on Intestinal Epithelial Cells responses may not be in inducing CXCL8 by itself, but in enhancing TNF-alpha- and IL-1-induced CXCL8 secretion to augment the contribution of IECs to local inflammatory responses. PMID: 28656529
  14. Despite the presence of all Notch pathway molecules in the kidney and a model-specific induction of Notch ligands, IL-22 was only up-regulated in acute inflammation, but rapidly down-regulated during regeneration. This implies that for targeting injury responses, e.g. via IL-22, species-specific differences, injury type and time points have to be considered. PMID: 29054964
  15. Suggest that IL-22 has various roles in tuberculosis immune responses. In particular, membrane-bound IL-22+ T cells may play important roles in the human immune response to Mycobacterium. PMID: 29050778
  16. this study shows immunoregulatory function of lacrimal glands -derived IL-22 in inhibiting IL-17-mediated ocular surface epitheliopathy in dry eye disease PMID: 28051088
  17. Serum IL-9 and IL-22 are associated with eosinophilia in cow's milk allergy, and decrease in these two cytokines with occurs with cow's milk elimination. PMID: 28934137
  18. Tracheal aspirates of patients infected by P. aeruginosa contain protease IV activity which further results in IL-22 degradation. This so far undescribed cleavage of IL-22 by a bacterial protease is likely to be an immune-evasion strategy that contributes to P. aeruginosa-triggered respiratory infections PMID: 27792459
  19. this study shows that copy number variations of the IL-22 gene are associated with ankylosing spondylitis in Chinese Han population PMID: 28716697
  20. IL-22 contributed to the inhibition of pulmonary microvascular endothelial cells apoptosis mediated by AngII through activating the JAK2/STAT3 signaling pathway. PMID: 28827891
  21. Findings provide a new perspective on the pro-inflammatory cytokine interleukin-22 in promoting aerobic glycolysis associated with tumor progression in human colon cancer cells. PMID: 28445985
  22. finding demonstrated that IL-22 could exert favorable effects on Diabetic nephropathy (DN) via simultaneously alleviating systemic metabolic syndrome and downregulating renal NLRP3/caspase-1/IL-1beta pathway, suggesting that IL-22 might have therapeutic potential for the treatment of DN. PMID: 28726774
  23. Our findings suggested that the IL-22 -429C/T gene polymorphisms might be associated with colon cancer. PMID: 28624523
  24. Authors found that SOCS3 and SOCS1 expression was reduced in vivo, in tumor lesions of BCC and SCC, as compared to other skin inflammatory conditions such as psoriasis, despite the high number of IL-22-secreting TILs. PMID: 28445952
  25. miR-330 inhibits IL-22-induced proliferation of HaCaT and HKC cell by targeting CTNNB1. PMID: 28501007
  26. IL-22 protects against sodium nitroprusside-induced apoptosis in rheumatoid arthritis-fibroblast-like synoviocytes by activating the STAT3 pathway and the downstream target gene, Bcl-2. PMID: 27493089
  27. IL22 plays a critical role in maintaining barrier homeostasis against intestinal pathogens and commensal bacteria, and, as a member of the IL10 superfamily, is critically involved in inflammation [Review] PMID: 29037907
  28. TARC production in HaCaT keratinocytes through the interaction between IL-22 and IL-22Ralpha facilitates T-cell migration in atopic dermatitis caused by house dust mites. PMID: 26914146
  29. IL-22 was found to be higher in PP than in PPMS (p<0.05). PMID: 27344023
  30. IL-22 is increased in patients with GCA and affects viability and gene expression of arterial cells, supporting a potential role in disease pathogenesis. PMID: 28968695
  31. suggest that the human IL-22BP isoforms have distinct spatial and temporal roles and coordinately fine-tune IL-22-dependent STAT3 responses in tissues as a type of rheostat. PMID: 27678220
  32. IL-18 cooperates with IL-15 to promote group 3 innate lymphoid cell (ILC3) proliferation and IL-22 production; describe an IL-18-induced, NF-kappaB-mediated mechanism that regulates IL-22 in ILC3s; at steady-state, IL-18 produced by dendritic cells mediates IL-22 production by ILC3s to help maintain normal tissue integrity PMID: 28842466
  33. results reveal that IL-22 increases intestinal epithelial permeability by upregulating Claudin-2 expression through the JAK/STAT pathway PMID: 28939759
  34. High serum levels of IL-22 were positively rather than inversely associated with several cardiometabolic risk factors. However, these associations did not translate into an increased risk for type 2 diabetes. PMID: 28143481
  35. mucosal-associated invariant T cells in the genital mucosa have a distinct IL-17/IL-22 profile and may have an important role in the immunological homeostasis and control of microbes at this site PMID: 27049062
  36. Results show that disease lavage IL-22 concentrations are highest in patients with pneumonia and lung cancer and does not significantly correlate with systemic inflammation. PMID: 27388918
  37. increased expression of IL-22Ralpha therefore promotes keratinocyte proliferation and pro-inflammatory cytokine production during UVB-induced skin inflammation, suggesting that UVB facilitates skin inflammation by increasing the responsiveness of keratinocytes to IL-22 PMID: 28558005
  38. In conclusion, Notch siganling appears to be an important mediator of the liver inflammation by modulating hepatic IL-22-secreting NKp46(+) innate lymphoid cells. PMID: 27800305
  39. High levels of IL-22 is associated with lyme disease. PMID: 27101991
  40. IL-23 released by keratinocytes in response to endogenous TLR4 ligands causes skin DCs, which selectively express IL-23R, to up-regulate their endogenous IL-23 production and drive an IL-22 response in naive CD4(+) T cells that mediates epidermal thickening. PMID: 27551155
  41. patients with T2DM and CAD exhibit increased serum IL-22 levels. Elevated serum IL-22 is associated with the incidence of CAD and T2DM. However, further in vitro study established the protective role of IL-22 against endothelial dysfunction, an essential process involved in the early development of atherosclerosis and vascular complications in T2DM. IL-22 might exert different functions under different context. PMID: 27829708
  42. plasma levels highly elevated after major liver resection PMID: 26853442
  43. IL-22 and its receptor have a crucial role in the development and pathogenesis of uveitis by facilitating inflammatory cell infiltration. PMID: 27166675
  44. there was no association between IL-22 SNPs (rs2227485, rs2272478, rs2227491) and the development of ulcerative colitis in a Mexican population PMID: 26994530
  45. The mutual benefit gained from interactions between the host and commensal intestinal bacteria-derived factors is an expanding field of research beginning to affect clinical practice. Data presented herein propose a supportive and fine-tuning role for butyrate in IL-22 signaling that might be therapeutically exploited by local butyrate administration PMID: 27801948
  46. this paper shows that human gammadelta T cell-antigen-presenting cells stimulate CD4+ T cell responses distinct from those induced by myeloid antigen-presenting cells to promote local barrier defense via mucosal release of IL-22 and calprotectin PMID: 28330898
  47. There was a significant direct correlation between levels of IL-10 and IL-22 in patients group (p=0.0005). The clinical severity of psoriasis was significantly correlated with high levels of IL-22 (p<0.0001). PMID: 27999243
  48. The levels of IL-22 mRNA in middle ear effusion of otitis media with effusion patients was higher in those with sinusitis than without. IL-22 expression was significantly higher in mucoid and purulent middle ear fluid samples than in serous fluid samples. PMID: 27729129
  49. IL-22 plays pathological roles in the development of recurrent hepatitis C after liver transplantation. PMID: 27123854
  50. The results suggest that IL-22 production in blood might act as a pathogenic factor in HIV infection. PMID: 25556046

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed