Recombinant Human IL18BP Protein (Fc Tag His Tag)

Collections: Cytokines and growth factors, Interleukins and receptors, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	O95998
Synonym	I18BP_HUMAN IL-18BP IL18 binding protein IL18 BP IL18 BPa IL18BP IL18BPa Interleukin 18 binding protein Interleukin-18-binding protein MC51L 53L 54L homolog gene product Tadekinig alfa Tadekinig-alfa
Description	Recombinant Human IL18BP Protein (Fc Tag His Tag) was expressed in Baculovirus infected insect cells. It is a Full length protein
Source	Baculovirus infected insect cells
AA Sequence	ADPTPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVP LNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTG TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLP PTQEALPSSHSSPQQQGLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH
Molecular Weight	45 kDa including tags
Purity	>90% purity as determined by SDS-PAGE
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
Subcellular Location	Secreted.
Database References	HGNC: 5987 OMIM: 604113 KEGG: hsa:10068 STRING: 9606.ENSP00000260049 UniGene: Hs.591967
Tissue Specificity	Strongly expressed in heart, lung, placenta and spleen.

Gene Functions References

these results were corroborated in female osteoporotic subjects where decreased serum IL-18BP levels and enhanced serum IL-18 levels were observed. Our study forms a strong basis for using humanized IL-18BP towards the treatment of postmenopausal osteoporosis. PMID: 27649785
epigenetic silencing by single CpG methylation determines differential IL18BP inducibility in monocytic versus epithelial cells. T PMID: 29409936
a large proportion blood basophils from patients with asthma express IL-18 and IL-18BP. mast cells and basophils are implicated in the pathogenesis of asthma via an IL-18-related mechanism. PMID: 29505668
The maintenance of normal production of IL-18BP may contribute, at least in part, to the ability ofLong Term Non-Progressors to delay AIDS progression. PMID: 27863336
Platelets also contain the IL-18 antagonist, the IL-18-Binding Protein (IL-18BP); however, it is not synthesized in them de novo, is present in pre-made form and is released irrespective of platelet activation. PMID: 27914933
The serum levels of IL-37, which were correlated with antibody production and the serum levels of total IL-18 and IL-18BP, were elevated in the patients with primary Sjogren's syndrome. PMID: 28057714
an imbalance in the production of IL-18 and its antagonist (an increase in the production of IL-18 with a decrease, no increase or an insufficient increase in the production of IL-18BP) has been described in many chronic inflammatory diseases in humans. PMID: 26898120
IL-18, IL-18R and IL-18BP expression in eosinophil are involved in the inflammatory reaction of asthma. PMID: 28395725
the inhibition of IL-18 signaling by IL-18BPa may be involved in the development of pulmonary vascular involvement leading to pulmonary hypertension and modulate the systemic inflammation in systemic sclerosis PMID: 26777734
The natural IL-18 inhibitor IL-18BP further regulates IL-18 activity in the extracellular environment. Review. PMID: 25548255
imbalance of IL-18/IL-18BP ratio in IgA nephropathy especially in patients with arteriolar lesions PMID: 25807634
IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma PMID: 24963217
HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes. PMID: 24478434
these data indicate that IL-18BP, which is produced in EOC in response to microenvironmental factors, may inhibit endogenous or exogenous IL-18 activity PMID: 23873689
Data suggest that the imbalance of IL-18/IL-18BP might play an important role in the pathogenesis of systemic juvenile idiopathic arthritis (SJIA) and it might go hand-in-hand with the severity of SJIA. PMID: 23419721
Due to highly significant increases in circulating IL-18BP in schizophrenia compared to controls, the levels of free IL-18 are not significantly different between schizophrenic groups. PMID: 22913567
Imbalance between IL-18 and IL-18BP may play an important role in pathogenesis of idiopathic thrombocytopenic purpura. PMID: 21867627
High IL-18 BP levels indicate the severity of existing glomerular injury in systemic lupus erythematosus. PMID: 21656327
The balance between interleukin-18 (IL-18) and its endogenous antagonist, IL-18 binding protein (IL-18BP), was evaluated in children with Henoch-Schonlein purpura. PMID: 22289535
IL-18/IL-18BP imbalance plays an important role in pathogenesis of primary immune thrombocytopenia. PMID: 21418867
In T2DM patients, 18 BP began to increase after IL-18 increased and reached a threshold, in which case kidney dysfunction would have developed. PMID: 21440322
increased levels of both IL-18 and its natural inhibitor IL-18BP, characterise SLE PMID: 21126942
In lines of intestinal epithelial cells from inflammatory bowel disease patients, interferon-gamma selectively up-regulated IL-18 binding protein. PMID: 21078084
lupus nephritis patients present lower IL-18BP mRNA expression and higher serum levels of IL-18 than those in normal controls PMID: 20140691
Altogether, data presented herein indicate that direct action of STAT1 on the IL-18BP promoter at the proximal GAS element is key to IL-18BP expression by IFN-gamma-stimulated DLD-1 colon carcinoma cells PMID: 19046253
High circulating levels in patients with active Systemic Lupus Erythematosus PMID: 19699611
Endometrial interleukin-18 binding protein mRNA expression may possibly be responsible for the pathologic process of adenomyosis. PMID: 19394601
Suggest that an early rise in IL-18 levels may play a role in reverse remodeling process following aortic valve replacement. PMID: 19961286
Since IL-18 plays a major role in perpetuating hemophagocytosis, the failure of IFNgamma to induce IL-18BP may constitute a fundamental pathogenetic mechanism PMID: 20072626
trancriptional activation and release of IL-18 binding protein in response to IFN-gamma PMID: 11739524
IL-18BP messenger transcript and protein are significantly increased in surgically resected specimens from active Crohn's disease compared with control patients, correlating with an up-regulation of IL-18. PMID: 11907126
after binding to IL-18BP, IL-1F7b forms a complex with IL-18Rbeta, depriving the beta-chain of forming a functional receptor complex with IL-18Ralpha and thus inhibiting IL-18 activity PMID: 12381835
IRF-1-CEBPbeta complex activate the promoter of IL-18 binding protein. PMID: 12482935
Administration of recombinant human IL-18BP not only reduces symptoms of murine contact hypersensitivity (CHS) during the elicitation phase but also significantly decreases inflammation in mice that had previously undergone CHS without treatment. PMID: 12874202
High endogenous levels of IL-18BP in trangenic mice effectively neutralize IL-18 and are protective in response to different inflammatory stimuli. PMID: 12960225
production of IL-18BP in response to IL-12 and IL-18 was regulated differently in blood and synovial cells. PMID: 15188356
IL-18 levels, which are determined in part by variation in IL18/IL18BP, play a role in coronary heart disease development and postsurgery outcome. PMID: 17951325
Despite the elevated IL-18BP levels during active disease, free IL-18 remained higher than in the inactive disease stages, suggesting a potential benefit of administration of exogenous IL-18BP as a therapeutic approach for active Wegener's granulomatosis. PMID: 18594952

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.