Recombinant Human IL18 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0448P
Recombinant Human IL18 Protein (His tag)
Beta LifeScience
SKU/CAT #: BLA-0448P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Accession | Q14116-1 |
Synonym | Iboctadekin IFN gamma inducing factor IFN-gamma-inducing factor IGIF IL 1 gamma IL 18 IL 1g IL-1 gamma IL-18 IL1 gamma IL18 IL18 protein IL18_HUMAN IL1F4 IL1g IL1gamma ILIF4 Interferon gamma inducing factor Interferon gamma-inducing factor Interleukin 1 gamma Interleukin 18 Interleukin 18 (interferon-gamma-inducing factor) Interleukin-1 gamma Interleukin-18 Interleukin18 MGC12320 |
Description | Recombinant Human IL18 Protein (His tag) was expressed in Yeast. It is a Full length protein |
Source | Yeast |
AA Sequence | MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRN LNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQ FESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED |
Molecular Weight | 25 kDa including tags |
Purity | >90% SDS-PAGE. |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |