Recombinant Human IL12 p35 Protein
Beta LifeScience
SKU/CAT #: BLA-0363P
Recombinant Human IL12 p35 Protein
Beta LifeScience
SKU/CAT #: BLA-0363P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Host Species | Human |
Synonym | CLMF CLMF p35 Cytotoxic lymphocyte maturation factor 35 kDa subunit IL-12 subunit p35 IL-12A IL12 p35 IL12 subunit p35 IL12A IL12A_HUMAN Interleukin 12 p35 Interleukin 12A Interleukin-12 subunit alpha NFSK NK cell stimulatory factor chain 1 NKSF1 |
Description | Recombinant Human IL12 p35 Protein was expressed in Wheat germ. It is a Protein fragment |
Source | Wheat germ |
AA Sequence | CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNM LAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTI DRVMSYLNAS |
Endotoxin | < 1.0 EU per μg of the protein as determined by the LAL method |
Formulation | Liquid Solution |
Stability | The recombinant protein samples are stable for up to 12 months at -80°C |
Reconstitution | See related COA |
Unit Definition | For Research Use Only |
Storage Buffer | Shipped on dry ice. Upon delivery aliquot and store at -80°C. Avoid freeze / thaw cycle. |