USA  Tel: 1-201-888-7983
Email: info@betalifesci.com

Recombinant Human HIV-1 gp120 (CN54) Protein

Cat No.: BLA-11286P
Description Related products
host species Human
accession ABL67444.1
synonym Envelope glycoprotein gp160
description Recombinant Human HIV-1 gp120 (CN54) Protein was expressed in HEK293. It is a Protein fragment
source HEK293
AA sequence TVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVL ENVTENFNMWKNDMVEQMHEDVISLWDQSLKPCVKLTPLCVTLECRQVNT TNATSSVNVTNGEEIKNCSFNATTEIRDKKQKVYALFYRLDIVPLEEERK GNSSKYRLINCNTSAITQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNG TGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLTNNVKTII VHLNESVEIVCTRPNNNTRKSIRIGPGQTFYATGDIIGNIRQAYCNIKKD DWIRTLQRVGKKLAEHFPRRIINFTSPAGGDLEITTHSFNCRGEFFYCNT SSLFNSTYNPNDTNSNSSSSNSSLDITIPCRIKQIINMWQEVGRAMYAPP IEGNITCKSNITGLLLVRDGGVESNETEIFRPGGGDMRNNWRSELYKYKV VEIKPLGIAPTAAKRRVVEREKR
molecular weight 54 kDa including tags
purity >95% SDS-PAGE.
endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
formulation Lyophilised
stability The recombinant protein samples are stable for up to 12 months at -80℃
reconstitution See related COA
unit definition For Research Use Only
storage buffer Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Online Inquiry
For quote, please fill in the online form or send email to info@betalifesci.com.
$50 Coupon