Recombinant Human GUCA2B Protein
Beta LifeScience
SKU/CAT #: BL-2529PS
Recombinant Human GUCA2B Protein
Beta LifeScience
SKU/CAT #: BL-2529PS
Collections: Other recombinant proteins, Recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Tag | His |
Host Species | Human |
Synonym | Guanylate cyclase activator 2B, UGN, GCAP-II, GUCA2B. |
Background | Prouroguanylin is a 112-amino-acid prohormone precursor of uroguanylin- mature biologically active 16-amino-acid peptide cleaved from its C-terminus. Guanylin binds to receptor-guanylate cyclases (CG-C) resulting in increased intracellular cGMP levels leading to CFTCR (Cystic Fibrosis Transmembrane Conductance Regulator) activation and subsequent rise in fluid and electrolyte secretion into the lumen.Prouroguanyline knock-out mice showed impaired renal excretion of external NaCl leading to elevated blood pressure independent of the level of diatary salt intake.Prouroguanylin is the predominant circulating molecular form found in circulation and in biological fluids. |
Description | Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86a.a. residues of the human prouroguanylin and 10 additionala.a. His Tag.The Prouroguanylin is purified by unique purification methods. |
Source | E.coli |
AA Sequence | MKHHHHHHASVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL. |
Purity | >95.0% as determined bySDS-PAGE. |
Endotoxin | <1.0 EU per μg by the LAL method. |
Formulation | 20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5. |
Stability | Recombinant protein is stable for 12 months at -70°C |
Usage | For Research Use Only |
Storage | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |