Recombinant Human Flt3 ligand / Flt3LG Protein

Beta LifeScience SKU/CAT #: BLA-0239P

Recombinant Human Flt3 ligand / Flt3LG Protein

Beta LifeScience SKU/CAT #: BLA-0239P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species Human
Accession P49771
Synonym FL Flt 3 ligand Flt 3L Flt3 L FLT3 LG Flt3 ligand Flt3L FLT3L_HUMAN Flt3lg Fms related tyrosine kinase 3 ligand Fms-related tyrosine kinase 3 ligand SL cytokine
Description Recombinant Human Flt3 ligand / Flt3LG Protein was expressed in Baculovirus infected Sf9 cells. It is a Full length protein
Source Baculovirus infected Sf9 cells
AA Sequence GTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWR LVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQT NISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLE ATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVP SPQDLLLVE
Molecular Weight 51 kDa including tags
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Formulation Liquid Solution
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.
Subcellular Location [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Database References

Gene Functions References

  1. our study demonstrates that Flt3L acts as an important regulator of ILCs lymphopoiesis and it can be used as a tool to expand and study ILCs precursors in the BM. PMID: 29317685
  2. Results elucidated a novel resistance mechanism that FL attenuated inhibitory effects of FLT3 inhibitors mainly through the activation of Wt-FLT3, not mutated FLT3 in acute myeloid leukemia. PMID: 27331411
  3. it is likely that TGFbeta1 and FL, both abundantly produced by bone marrow stromal cells, function in a coordinated manner to render mixed-lineage leukemia gene-rearranged acute lymphoblastic leukemia cells chemoresistant PMID: 28917156
  4. serum levels can be a marker of cutaneous manifestation in dermatomyositis and marker of microangiopathy in systemic sclerosis PMID: 26559027
  5. Pre-treatment serum levels of FLT3-L were higher than controls. FLT3-L correlated positively with all soluble angiogenic factors, as well with bone marrow microvascular density. Post-treatment FLT3-L decreased significantly in responders to therapy. PMID: 26521986
  6. The immunohistochemical expression of caveolin-1 and podocalyxin in lungs from rats challenged with a 2-kDa macrophage-activating lipopeptide (MALP-2) and Flt3L, was examined. PMID: 24419512
  7. Flt3L enhances global T cell and humoral immunity as well as both the numbers and antigen capture capacity of migratory dendritic cells and classical lymphoid-resident dendritic cells PMID: 25135299
  8. Human bone marrow stromal cells simultaneously support B and T/NK lineage development from human haematopoietic progenitors: a principal role for flt3 ligand in lymphopoiesis. PMID: 22463758
  9. A novel dendritic cell(DC) progenitor regulatory pathway in which PGE(2) signaling through EP1/EP3 receptors regulates Flt3 expression and downstream STAT3 activation and survivin expression, required for optimal progenitor survival and differentiation. PMID: 22110249
  10. data demonstrate that the Flt3L/TK gene therapeutic approach can induce systemic immunological memory capable of recognizing a brain tumor neoantigen in a model of recurrent GBM PMID: 21505426
  11. FLT3 ligand(FL) leads to further activation of FLT3 mutants and is especially important in light of recent findings of elevated FL levels in acute myeloid leukemia patients in response to chemotherapy. PMID: 21516120
  12. FLT3 ligand impedes the efficacy of FLT3 inhibitors in vitro and in vivo. PMID: 21263155
  13. results demonstrate that hsFlt3L induces the proliferation of canine DCs and support its use in upcoming clinical trials for canine glioblastoma multiforme PMID: 20552015
  14. Exogenous administration of Flt3 ligand increases the CD11c-expressing dendritic cell population, which, when expressing IL-15, significantly expands mature natural killer (NK) cells via enhanced survival and proliferation. PMID: 20142363
  15. Data suggest that Flt3 Ligand(FL) gene regulated by Egr-1 promoter can protect hematopoiesis from 5-Fu injury. PMID: 19426596
  16. Treatment with recombinant human FLT3 ligand prevents ovalbumin-induced asthma in the mouse by stimulating IL-12 secretion by dendritic cells. It may provide a useful adjuvant in the treatment of human asthma. PMID: 11710537
  17. effect of recombinant human Flt-3 ligand on dendritic cell populations in mouse spleen PMID: 11877288
  18. Expression of FLT3L in primary gastrointestinal non-Hodgkin's lymphoma. PMID: 11956621
  19. Antiapoptotic cytokine IL-3 + SCF + FLT3L influence on proliferation of gamma-irradiated AC133+/CD34+ progenitor cells. PMID: 12002675
  20. Incubation of acute stem cell leukemia cells with the flt3 ligand induced the expression of unilineage HGF receptors, allowing cell growth without differentiation . PMID: 12036900
  21. Flt3L-mobilized DC from cancer patients require a sequence of specific signals for maturation, including initial treatment with granulocyte macrophage-colony stimulating factor followed by a combination of maturation signals such as CD40L and IFN-gamma. PMID: 12223523
  22. Administration of Flt3-L enhances a Th1-type response against mouse thyroglobulin by selective expansion of mouse dendritic cell subsets that results in induction of a severe type of murine autoimmune thyroiditis. PMID: 12759428
  23. A single dose of recombinant human Flt3L locally applied in the trachea of rats results in a dose-dependent increase of dendritic cells as well as CD4+ and CD8+ T lymphocytes with different responses in lung interstitium and bronchoalveolar space. PMID: 12817014
  24. Thrombopoietin cooperates with FLT3-L, inducing CD34+ HPCs to undergo a 400-fold expansion in cell numbers. PMID: 14670916
  25. endogenous FLT3LG has distinct effects on the kinetics of reconstitution of DCs and NK ce; speed of recovery of CD11c(+)CD123(low) DC1 exceeded that of CD11c(-) CD123(+) DC2, and correlated with plasma levels of flt3 ligand PMID: 14764540
  26. flt3L is a potent immunorestorative agent that enhances both thymic-dependent and thymic-independent pathways of T-cell regeneration PMID: 15226184
  27. Increased serum levels of the early hemopoietic cytokine FLT3-L could explain increased numbers of circulating dendritic cells in Langerhans cell histiocytosis. PMID: 15728521
  28. Human flt3 ligand-mediated generation and mobilization of naive dendritic cells, fully responsive to infectious stimuli, accelerates recovery from endotoxin tolerance-related immunoparalysis in a murine infection model. PMID: 15905588
  29. Purified recombinant FLT3 ligand had dose-dependent expansion activity on bone marrow nucleated cells. PMID: 15914030
  30. Addition of Flt3-L to the optimal combination of megakaryocyte (Mk) growth factor MGDF, stem cell factor, interleukin-3, and granulocyte-macrophage colony stimulating factor GM-CSF reduces both fold expansion of Mk progenitors and Mk colony numbers. PMID: 16487027
  31. Flt-3L treatment expands conventional & plasmacytoid dendritic cells in vivo, increasing antigen presentation by direct- & cross-presentation. It augments the size of an immune response but requires further adjuvant activation to alter its quality. PMID: 17949888
  32. Results indicate that Flt3-L is strongly expressed at the site of inflammation in human rheumatoid arthritis, and it exerts both pro-inflammatory and tissue destructive properties once in the joint cavity. PMID: 18982072

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

Recently viewed