host species |
Human |
accession |
P16772 |
synonym |
HCMV HHV5 Human Herpesvirus 5 UL55 (strain AD169) |
description |
Recombinant Human Cytomegalovirus AD169 Protein (Tagged) was expressed in E.coli. It is a Protein fragment |
source |
E.coli |
AA sequence |
SPWSTLTANQNPSPPWSKLTYSKPHDAATFYCPFLYPSPPRSPLQFSGFQ QVSTGPECRNETLYLLYNREGQTLVERSSTWVKKVIWYLSGRNQTILQRM PQTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLRFVVNDGTRYQMCVMK LESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV |
molecular weight |
38 kDa including tags |
purity |
>90% SDS-PAGE |
endotoxin |
< 1.0 EU per μg of the protein as determined by the LAL method |
formulation |
Liquid Solution |
stability |
The recombinant protein samples are stable for up to 12 months at -80℃ |
reconstitution |
See related COA |
unit definition |
For Research Use Only |
storage buffer |
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |