Recombinant Human CD200 / OX2 Protein

Collections: Car-nk targets proteins, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	P41217
Synonym	Antigen identified by monoclonal antibody MRC OX 2 CD200 CD200 antigen CD200 molecule MOX1 MOX2 MRC MRC OX 2 antigen My033 OX 2 OX 2 membrane glycoprotein precursor OX-2 membrane glycoprotein OX2G OX2G_HUMAN
Description	Recombinant Human CD200 / OX2 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSE NHGVVIQPAY KDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY VQPIVSLHYK FSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILH IKDPKNQVGK EVICQVLHLGTVTDFKQTVNKGVDHHHHHH
Molecular Weight	23 kDa including tags
Purity	>95% SDS-PAGE.Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at -80°C.

Target Details

Target Function	Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
Subcellular Location	Cell membrane; Single-pass type I membrane protein.
Database References	HGNC: 7203 OMIM: 155970 KEGG: hsa:4345 STRING: 9606.ENSP00000420298 UniGene: Hs.79015

Gene Functions References

overexpression of human CD200 in donor pigs could constitute a promising strategy for overcoming xenograft rejection. PMID: 28968355
Our results support the fact that CD200 can be added to routine Chronic lymphoproliferative disorders panel as it is useful in subcategorizing them. However, inclusion of CD20 ABC to routine panel does not seem plausible but may be done for difficult diagnostic cases or where anti-CD20 therapy is planned. PMID: 29567884
A diligent morphological examination to look for the presence of hairy cells along with flow cytometric immunophenotyping showing consistent bright expression of CD200, in addition to well-described characteristic immunophenotype, helps in correctly diagnosing the case. This can be further confirmed by the consistent presence of V600E point mutation in BRAF gene. PMID: 30197362
CD200(+) and/or CD56(+) positive expression in B-ALL patients at diagnosis is a poor prognostic biomarker. PMID: 29161980
CD200 was expressed in 97.3% of atypical chronic lymphocytic leukemia cases, whereas it was dimly expressed in only 6.1% of mantle cell lymphoma cases. PMID: 28713070
CD200 and/or CD56 positive expression in B-ALL at diagnosis suggest a poor prognosis and may be associated with biological aggressiveness. PMID: 29144828
downregulation of CD200 expression resulted in an imbalance of increased Th1 cytokine and decreased Th2 cytokine production in placental trophoblasts in preeclampsia PMID: 28940677
This is the first report of CD200 mRNA and protein expression in patients with transitional cell carcinoma of the human bladder. TCC tissues showed significantly higher CD200 expression than normal bladder tissues. CD200 signals were also higher in metastasized compared to localized TCC. The data provide a strong indication for a putative role of CD200 in the immune-evasion of bladder cancer. PMID: 29715095
Our data confirm a negative impact of ABCG2 and CD200 overexpression also in AML patients considered at favorable risk according to ELN cytogenetic/molecular classification. PMID: 28618016
Residual CD200 activity may prevent completion of abortions via induction of Treg cells. In chronic histiocytic intervillositis, infiltrating maternal effector T cells may block Treg induction. An autocrine role for CD200-CD200R interaction versus inhibition of soluble CD200 by soluble CD200R is discussed. PMID: 28326648
patients with Autosomal dominant polycystic kidney disease have activated soluble CD200 levels which were related to renal function and inflammation. PMID: 28179401
correlation of sCD200 serum levels with COPD-related parameters in humans with established disease revealed that the CD200/CD200R axis may be mechanistically linked to the disease course in COPD patients. PMID: 27864635
It suppresses macrophage-mediated xenogeneic cytotoxicity and phagocytosis. PMID: 28573328
High expression of CD200 is associated with chronic lymphocytic leukemia. PMID: 26910908
It is a anti-inflammatory protein. PMID: 28390825
CD200 expression therefore may be used to help identify pulmonary small cell carcinoma in flow cytometry specimens. PMID: 26584149
Our data suggest a negative impact of CD200 expression in cytogenetically-normal acute myeloid leukemia PMID: 28407515
CD200 was expressed in 87% of the neuroendocrine neoplasms studied. CD200 is a relatively sensitive marker of neuroendocrine neoplasms and represents a potential therapeutic target in these difficult-to-treat malignancies. PMID: 28821198
Up-regulation of CD200 in MDS predicts poor prognosis. PMID: 28152413
this study shows that that CD200 suppresses the immune system's response to vaccines, and that blocking CD200 could improve the efficacy of cancer immunotherapy PMID: 27485078
These results suggest that CD200S activates TAMs to become DC-like antigen presenting cells, leading to the activation of CD8(+) cytotoxic T lymphocytes, which induce apoptotic elimination of tumor cells. PMID: 27108386
increased expression of CD200, expansion of suppressive Treg cells and elevation of cytokines might have a role in multiple myeloma progression PMID: 26033514
In the present study, we showed for the first time a correlation between CD200 expression and the Wnt signaling pathway in colon cancer cells. PMID: 27574016
data confirms that a functionally active CD200 extracellular moiety can be cleaved from the surface of CD200 expressing cells following ectodomain shedding PMID: 27111430
CD200 is a poor prognostic factor for overall survival in multiple myeloma (MM) patients. Bone marrow CD3 lymphocytes from MM patients express CD200 protein in higher proportion than healthy donors. PMID: 26177431
CD200 expression by cultured cultured bone marrow mesenchymal stem cells can be induced by both osteogenic and pro-inflammatory cytokines through the sole NF-kappaB pathway. PMID: 26773707
suggest that microglial activation may be partially caused by CD47/signal regulatory protein-alpha- and CD200/CD200R-mediated reductions in the immune inhibitory pathways PMID: 27095555
CD200 is up-regulated and may be a novel biomarker for the prognosis in cutaneous squamous cell carcinoma. PMID: 27035797
CD200 expression is a useful marker for evaluation of the severity of PCM and that lack of CD200 expression may improve the sensitivity of PCM to therapy with new drugs. PMID: 26763359
the combination of CD200 and CD148 may have a potential differential diagnostic value in leukemic B-CLPDs, especially between CLL and MCL. PMID: 25791119
CD200-CD200R1 signaling may be required for human pregnancy success. PMID: 26123445
CD200 signaling may play a key role in regulating macrophage polarization toward anti-inflammatory phenotypes PMID: 26670206
Suggest CD200 as both prognostic factor and potential therapeutic target AML, aiming to reverse the "do not eat me" signal of CD200 or to manipulate the suppressive immune microenvironment induced by CD200 binding to its receptor. PMID: 26338961
CD160 and CD200 are expressed in B cells in chronic lymphocytic leukemia and are absent in other mature B-cell neoplasms. PMID: 25470765
our study confirms that CD200/BTLA deletions are recurrent genetic lesions in the biology of BCP-ALL PMID: 26137961
CD200 antigen expression features response for chemoradiation in patients squamous cell head and neck cancer. PMID: 24700450
CD200 expression by early-stage human breast cancer cells in primary tumors did not correlate with increased regional lymph node metastasis. PMID: 25041579
The proportion of CD200+ cells in PBMCs, peripheral CD14+ cells and CD4+ T cells was significantly lower in rheumatoid arthritis patients compared to controls, whereas the number of CD200+ cells was higher in synovium from RA patients than from controls. PMID: 25261692
Prognostic value of CD200 detected in malignant ascites from patients with metastatic ovarian, endometrial and breast neoplasms remains to be elucidated. PMID: 25778329
We demonstrate a significant correlation between CD200R1 positive cells and disease severity in rheumatoid arthritis (RA) patients, thus indicating the relevance of the CD200/CD200R1 signaling pathway potential involvement in the pathogenesis of RA. PMID: 24496593
The mechanism underlying ESA might be associated with enhanced expression of CD200 and CD200R in the trophoblast, leading to an upregulation of the immune response during the first trimester of pregnancy. PMID: 25145957
The results expand the understanding of the CD200 expression in mature B-cell neoplasms , giving further support for the inclusion of this marker in the routine investigation by flow cytometry. PMID: 24243815
staining by flow cytometry can be useful in the differential diagnosis of B-cell neoplasms and in their detection in the bone marrow PMID: 25389338
CD200 is expressed in a majority of plasma cell myeloma cases, and the expression is stable during the treatment process. PMID: 24958785
The soluble OX-2 levels of type 2 diabetic foot were compared with that of healthy controls. PMID: 24964809
The expression of CD200 as well as B7-H4 co-stimulatory molecules on CD14(+) cells were significantly higher in cord blood when compared with peripheral blood. PMID: 23066977
Measurement of sCD200 and/or sCD200R1 may prove a useful and rapid means of monitoring subjects at risk of bone loss. PMID: 24333170
expression of CD200 in the bone marrow of chronic lymphocytic leukemia PMID: 24405602
[review] Inhibitory receptors are separated into two major classes based on their extracellular domains: immunoglobulin (Ig) and carbohydrate-binding C-type lectin families. PMID: 24388216
Soluble CD200 might play a role in immune response in the pathogenesis of autoimmune and inflammatory skin disorders. PMID: 24157657

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.