Recombinant Human ACE2 Protein

Collections: Other recombinant proteins, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	Q9BYF1
Synonym	ACE 2 ACE related carboxypeptidase ACE-related carboxypeptidase ACE2 ACE2_HUMAN ACEH Angiotensin converting enzyme 2 Angiotensin converting enzyme homolog Angiotensin converting enzyme like protein Angiotensin I Converting Enzyme (peptidyl dipeptidase A) 2 Angiotensin I converting enzyme 2 Angiotensin-converting enzyme homolog DKFZP434A014 EC 3.4.17 metalloprotease MPROT 15 Metalloprotease MPROT15 OTTHUMP00000022963 Processed angiotensin-converting enzyme 2
Description	Recombinant Human ACE2 Protein was expressed in HEK293. It is a Protein fragment
Source	HEK293
AA Sequence	QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGD KWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLN TILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWES WRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDY SRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLL GDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVS VGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMD DFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKH LKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGE IPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYT RTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWT LALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQS IKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGE EDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRL NDNSLEFLGIQPTLGPPNQPPVSVDHHHHHH
Molecular Weight	85 kDa including tags
Purity	>95% SDS-PAGE.
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Formulation	Liquid Solution
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Essential counter-regulatory carboxypeptidase of the renin-angiotensin hormone system that is a critical regulator of blood volume, systemic vascular resistance, and thus cardiovascular homeostasis. Converts angiotensin I to angiotensin 1-9, a nine-amino acid peptide with anti-hypertrophic effects in cardiomyocytes, and angiotensin II to angiotensin 1-7, which then acts as a beneficial vasodilator and anti-proliferation agent, counterbalancing the actions of the vasoconstrictor angiotensin II. Also removes the C-terminal residue from three other vasoactive peptides, neurotensin, kinetensin, and des-Arg bradykinin, but is not active on bradykinin. Also cleaves other biological peptides, such as apelins (apelin-13, Non-functional as a carboxypeptidase.; (Microbial infection) Acts as a receptor for human coronaviruses SARS-CoV and SARS-CoV-2, as well as human coronavirus NL63/HCoV-NL63.; (Microbial infection) Non-functional as a receptor for human coronavirus SARS-CoV-2.
Subcellular Location	[Processed angiotensin-converting enzyme 2]: Secreted.; Cell membrane; Single-pass type I membrane protein. Cytoplasm. Cell projection, cilium. Apical cell membrane.; [Isoform 2]: Apical cell membrane.
Protein Families	Peptidase M2 family
Database References	HGNC: 13557 OMIM: 300335 KEGG: hsa:59272 STRING: 9606.ENSP00000252519 UniGene: Hs.178098
Tissue Specificity	Expressed in endothelial cells from small and large arteries, and in arterial smooth muscle cells (at protein level). Expressed in enterocytes of the small intestine, Leydig cells and Sertoli cells (at protein level). Expressed in the renal proximal tubul

Gene Functions References

Report no influence of ACE2 gene polymorphism on stroke recurrence and only find possible interaction between hypertension history and the ACE2 gene in male stroke patients. PMID: 30056001
In a Chinese Han population, five single-nucleotide polymorphisms (SNP) (rs1514283, rs4646155, rs4646176, rs2285666, and rs879922) in ACE2 gene were determined to significantly associate with essential hypertension in female participants, while no SNP locus was linked to male group. PMID: 30335025
ACE2 and other enzymes can form ANG-(1-7) directly or indirectly from either the decapeptide ANG I or from ANG II. [review] PMID: 29351514
Suggest a potential role for ACE2 polymorphism in postexercise hypotension in hypertensive medicated individuals. PMID: 27925380
ACE2 SNPs and haplotypes are associated with circulating angiotensin-(1-7) levels. PMID: 28895159
we found an interaction between ACE2 and AGTR1 in structuralatrial fibrillation patients in a Chinese Han population PMID: 29441892
results suggest that ACE2, TNNI3K and CALM3 polymorphisms are associated with increased risk of hypertrophic cardiomyopathies and dilated cardiomyopathies and may act as disease modifiers of these diseases. PMID: 28744816
Elevated plasma ACE2 is significantly associated with more advanced LA structural remodeling in atrial fibrillation. PMID: 27738071
Overexpression of ACE2 in monocytes led to reduced endothelial adhesion, transmigration and downregulation of adhesion-related molecules and results in atherosclerosis. PMID: 28186543
These results indicated that aberrant methylation of the ACE2 promoter may be associated with EH risk. In addition, sex may significantly influence ACE2 methylation. PMID: 28440441
ACE2 rs2106809 is an important predictive factor of the response to antihypertensive treatment with ACE inhibitors in Chinese female hypertensive patients. PMID: 27121444
In islets from db/db mice, ACE2 over-expression increased intracellular calcium influx and restored impaired mitochondrial oxidation, potentially causing an increase in GSIS. These results shed light on the potential roles of ACE2 in mitochondrial metabolism, moreover, may improve our understanding of diabetes. PMID: 29128354
ACE2 may have a role in silent atherosclerosis in patients with chronic kidney disease; it counterbalances the vasoconstrictor adverse effects of angiotensin II by its conversion PMID: 27615597
This study reveals an elevated serum concentration of ACE2 and independent associations between serum ACE2 and echocardiographic parameters in hypertensive patients. PMID: 28223093
The findings of this study indicate that ACE-2 activity is reduced in AD and is an important regulator of the central classical ACE-1/Ang II/AT1R axis of renin-angiotensin system, and also that dysregulation of this pathway likely plays a significant role in the pathogenesis of Alzheimer's disease. PMID: 27884212
Overexpression of ACE2 ameliorates Abeta-induced inflammatory response by activating the ACE2/Ang-(1-7)/Mas axis in human RPE cells. PMID: 28605813
Although further studies are required to determine how clusterin suppresses non-specific cellular uptake in phagocytes, our data suggest that clusterin plays a key role in the stealth effect of not only pegylated nanoparticles but also non-pegylated nanoparticles. PMID: 27983983
The ACE2 G8790A polymorphism in type 2 diabetes mellitus patients was correlated with cerebral stroke, and the A allele might be a risk factor of type 2 diabetes mellitus combined with cerebral stroke. PMID: 27500554
ollectrin, an ACE2 homolog with no catalytic activity, regulates blood pressure through an NO-dependent mechanism. Large body of experimental data confirmed sustained beneficial effects of ACE2/Ang-(1-7)/Mas receptor axis activation on hypertension and vascular injury. PMID: 27889958
The potential contribution of the ACE2 to cardiovascular disease progression was addressed. PMID: 27965422
Serum ACE2 activity was significantly lower in acute ischemic stroke as compared to both control and stroke-alert patients, followed by an increase to control levels at three days. PMID: 27488276
Here, we review the role and effects of ACE2, ACE2 activators, Ang-(1-7) and synthetic Mas receptor agonists in the control of inflammation and fibrosis in cardiovascular and renal diseases and as counter-regulators of the ACE-Ang II-AT1 axis. PMID: 26995300
ACE2 overexpression inhibited cell growth. PMID: 27460845
Downregulation of ACE2/Ang-(1-7)/Mas axis stimulates breast cancer metastasis through the activation of store-operated calcium entry and PAK1/NF-kappaB/Snail1 pathways. PMID: 27063099
The circulating ACE2 and Ang-(1-7) levels were related to neither rs4646155 nor rs879922 in female or male patients.In conclusion, the rs2106809 polymorphism of the ACE2 gene may be a determinant of the circulating Ang-(1-7) level in female patients with hypertension, suggesting a genetic association between circulating Ang-(1-7) levels and ACE2 gene polymorphisms in patients with hypertension. PMID: 27310975
These results indicated that angiotensin-(1-7)/ACE2/Mas axis may reduce liver lipid accumulation partly by regulating lipid-metabolizing genes through ATP/P2 receptor/CaM signaling pathway. PMID: 26883384
ACE-2 significantly increased when IMR-90 were hypoxic prior to hyperoxic exposure with no recovery. PMID: 27093376
Imbalanced down-regulation of ACE and ACE2 mRNA expression levels may play an important role in the development and progression of thoracic aortic aneurysmal dilatation and subsequently dissection. PMID: 25237166
These results suggest that the ACE2 G8790A and rs2106809 polymorphisms may be associated with essential hypertension risk. PMID: 25237167
ACE and ACE2 expression at the mRNA and protein levels are significantly increased in the myocardium of patients with heart failure. PMID: 25869724
Multivariable regression analysis revealed that urinary L-FABP and urinary albumin/ creatinine ratio were significantly associated with urinary ACE2 levels. PMID: 26067610
ACE2 and Ang-(1-7) significantly inhibit early atherosclerotic lesion formation via protection of endothelial function and inhibition of inflammatory response. PMID: 25721616
ACE-2 is expressed in fetal human lung fibroblasts but is significantly decreased by hyperoxic gas PMID: 25665060
urinary ACE2 increased in type 2 diabetic patients with various degrees of albuminuria PMID: 25791940
soluble ACE2 is involved in the pathomechanism of hypertension and heart failure. PMID: 24691269
Decrease in circulating ACE2 activity was associated with cardiovascular disease in patients with chronic kidney disease. PMID: 25813276
By genetic replenishment of ACE2 and pharmaceutical use of ARB, restored ACE2 level mitigated GBC growth. Our results supported the rationale for the use of ARB in GBC patients for potential therapeutic benefit PMID: 25663464
There is no clear association between ACE2 gene A9570G polymorphisms and childhood primary nephrotic syndrome. PMID: 25815490
Our results revealed that SNPs rs2074192 and rs714205 in ACE2 gene were associated with the susceptibility of DR and PDR. PMID: 25359286
Olmesartan may uniquely increase urinary ACE2 level in hypertensive patients, which could potentially offer additional renoprotective effects. PMID: 24842388
Hepatocellular carcinoma patients with higher level of ACE2 expression had longer survival time than those with lower level of ACE2 expression. PMID: 25701390
Urinary ACE2 activity and protein expression are increased in type 1 diabetes patients prior to the onset of clinical complications. PMID: 24920267
Brain endoplasmic reticulum stress does not contribute to DOCA-salt hypertension and ACE2 blunts neurogenic hypertension independently of ER stress. PMID: 25519733
Partial loss of ACE2 is sufficient to enhance the susceptibility to heart disease. PMID: 24728465
These data demonstrate that MSCs modified to overexpress the ACE2 gene can produce biologically active ACE2 protein over a sustained period of time and have an enhanced ability to promote endothelial repair after LPS challenge PMID: 25200929
ACE2 cleavage is regulated by influenza A H1N1 neuraminidase. PMID: 24662240
among females ACE2 rs2106809 polymorphisms,and among males ACE2 rs2106809 polymorphism and alcohol consumption are associated with essential hypertension PMID: 24112034
Data suggest angiotensin (ANG) converting enzyme 2/ANG-II-(1-7)/proto-oncogene protein Mas axis regulates inflammation/fibrosis, cell proliferation, and leukocyte recruitment/activation; main topic here is kidney/inflammatory renal disease. [REVIEW] PMID: 23488800
ACE2 and FZD1 are prognosis markers in squamous cell/adenosquamous carcinoma and adenocarcinoma of gallbladder. PMID: 23921915
ACE2 overexpression in the rostral ventrolateral medulla attenuates the enhanced tonically active glutamatergic input in SHRs, which may be an important mechanism underlying the beneficial effect of central ACE2 to hypertension. PMID: 24838502

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.